ACCN3 Antibody - N-terminal region (ARP35152_T100)

Catalog No: ARP35152_T100

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: ACCN3
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target: ASIC3
Positive control (+): Hela (HL)
Negative control (-): HepG2 (HG)
Antibody concentration: 2.5ug/ml

Human kidney

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACCN3
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 80%; Dog: 80%; Guinea Pig: 80%; Horse: 80%; Human: 100%; Mouse: 87%; Pig: 87%; Rabbit: 87%; Rat: 87%
• Peptide Sequence: Synthetic peptide located within the following region: VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-ASIC3 (ARP35152_T100) antibody is Catalog # AAP35152 (Previous Catalog # AAPP06382)
• Reference: Jones,N.G., et al., (2004) J. Neurosci. 24(48), 10974-9

Target Info

• Gene Symbol: ASIC3
• Gene Full Name: Acid-sensing (proton-gated) ion channel 3
• Alias Symbols: ACCN3, TNaC1, DRASIC, SLNAC1
• NCBI Gene Id: 9311
• Protein Name: Acid-sensing ion channel 3
• Description of Target: ACCN3 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. ACCN3 encodes a member that is an acid sensor and may play an important role in the detection of lasting pH changes. In addition, a heteromeric association between this member and ACCN1 has been observed as proton-gated channels sensitive to gadolinium.
• Uniprot ID: Q9UHC3
• Protein Accession #: NP_004760
• Nucleotide Accession #: NM_004769
• Protein Size (# AA): 531
• Molecular Weight: 58kDa
• Protein Interactions: ASIC3; LIN7B; GOPC; INADL; DLG4; MAGI1; ASIC2; STOM; CSNK2A1; PRKACA; STOML1;