Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP37513_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP37513_P050-FITC Conjugated

ARP37513_P050-HRP Conjugated

ARP37513_P050-Biotin Conjugated

A630025C20RIK Antibody - N-terminal region (ARP37513_P050)

Catalog#: ARP37513_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-163009 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse A630025C20RIK
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-A630025C20RIK (ARP37513_P050)
Peptide Sequence Synthetic peptide located within the following region: QQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Lcor (ARP37513_P050) antibody is Catalog # AAP37513 (Previous Catalog # AAPP09621)
Datasheets/Manuals Printable datasheet for anti-Lcor (ARP37513_P050) antibody
Target Reference Kunieda,T., et al., (2003) FEBS Lett. 535 (1-3), 61-65
Gene Symbol Lcor
Official Gene Full Name Ligand dependent nuclear receptor corepressor
Alias Symbols Mlr2, mKIAA1795, 3110023F06Rik, A630025C20Rik
NCBI Gene Id 212391
Protein Name Ligand-dependent corepressor
Description of Target This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project, a systematic approach to determining the full coding potential of the mouse genome, involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome.
Swissprot Id Q6ZPI3
Protein Accession # NP_742166
Nucleotide Accession # NM_172154
Protein Size (# AA) 433
Molecular Weight 48kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express A630025C20RIK.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express A630025C20RIK.
  1. What is the species homology for "A630025C20RIK Antibody - N-terminal region (ARP37513_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "A630025C20RIK Antibody - N-terminal region (ARP37513_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "A630025C20RIK Antibody - N-terminal region (ARP37513_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "A630025C20RIK Antibody - N-terminal region (ARP37513_P050)"?

    This target may also be called "Mlr2, mKIAA1795, 3110023F06Rik, A630025C20Rik" in publications.

  5. What is the shipping cost for "A630025C20RIK Antibody - N-terminal region (ARP37513_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "A630025C20RIK Antibody - N-terminal region (ARP37513_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "A630025C20RIK Antibody - N-terminal region (ARP37513_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "A630025C20RIK Antibody - N-terminal region (ARP37513_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "LCOR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LCOR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LCOR"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LCOR"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LCOR"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LCOR"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:A630025C20RIK Antibody - N-terminal region (ARP37513_P050)
Your Rating