website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ANAPC7 antibody - C-terminal region (ARP41605_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP41605_P050-FITC Conjugated

ARP41605_P050-HRP Conjugated

ARP41605_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Anaphase promoting complex subunit 7
Protein Name:
Anaphase-promoting complex subunit 7
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8).The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3; MIM 116946), CDC16 (APC6; MIM 603461), and CDC23 (APC8; MIM 603462).[supplied by OMIM].
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ANAPC7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ANAPC7.
The immunogen is a synthetic peptide directed towards the C terminal region of human ANAPC7
Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-ANAPC7 (ARP41605_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ANAPC7 (ARP41605_P050) antibody is Catalog # AAP41605 (Previous Catalog # AAPP24288)
Datasheets / Downloads:
Printable datasheet for anti-ANAPC7 (ARP41605_P050) antibody
Target Reference:
Turnell,A.S., (2005) Nature 438 (7068), 690-695

Product Protocols: ANAPC7 antibody tested with Human Jurkat Cells (ARP41605_P050)

Aviva Systems Biology is the original manufacturer of this ANAPC7 antibody (ARP41605_P050)

Click here to view the ANAPC7 antibody Western Blot Protocol

Product Datasheet Link: ANAPC7 antibody (ARP41605_P050)

WB Suggested Anti-ANAPC7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:

Description of Target: The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8).The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3; MIM 116946), CDC16 (APC6; MIM 603461), and CDC23 (APC8; MIM 603462).[supplied by OMIM].

Questions pertaining to this data can be directed to

Aviva Systems Biology’s ANAPC7 antibody (ARP41605_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: ANAPC7 antibody tested by IHC with human intestine (ARP41605)

Aviva Systems Biology is the original manufacturer of this ANAPC7 antibody.

Click here to view the ANAPC7 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: ANAPC7 antibody (ARP41605)

IHC Information:

Rabbit Anti-ANAPC7 Antibody
Catalog Number: ARP41605
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question