SIRT1 Antibody - N-terminal region (ARP32386_P050)

Catalog No: ARP32386_P050

Lanes:
1. 45ug capan1 cell lysate
2. 45 ug HPAF cell lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-Rabbit HRP
Secondary Antibody Dilution:
1:5000
Gene Name:
SIRT1
Submitted by:
Dr. Pankaj Singh, UNMC, Omaha, NE

Host: Rabbit
Target Name: SIRT1
Sample Tissue: Human 786-0
Antibody Dilution: 1.0ug/ml

Rabbit Anti-SIRT1 Antibody
Catalog Number: ARP32386_P050
Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue
Observed Staining: Cytoplasm, Nucleus
Primary Antibody Concentration: 1:600
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SIRT1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: PETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SIRT1 (ARP32386_P050) antibody is Catalog # AAP32386
• Reference: Solomon,J.M., et al., (2006) Mol. Cell. Biol. 26 (1), 28-38
• Publications:

  Cueno, M. E., Imai, K., Tamura, M. & Ochiai, K. Butyric acid-induced rat jugular blood cytosolic oxidative stress is associated with SIRT1 decrease. Cell Stress Chaperones. doi:10.1007/s12192-013-0462-7 (2013). 24052229

  Hsu, C.-Y. & Chuang, Y.-L. Changes in Energy-Regulated Molecules in the Trophocytes and Fat Cells of Young and Old Worker Honeybees (Apis mellifera). J. Gerontol. A. Biol. Sci. Med. Sci. (2013). doi:10.1093/gerona/glt163 24149426

  Hsu, C.-Y. & Hu, T.-H. Energy-regulated molecules maintain young status in the trophocytes and fat cells of old queen honeybees. Biogerontology 15, 389-400 (2014). 24973265

  Localization of sirtuins (SIRT1-7) in the aged mouse inner ear. Acta Otolaryngol. 136, 120-31 (2016). 26472659

Target Info

• Gene Symbol: SIRT1
• Gene Full Name: Sirtuin 1
• Alias Symbols: SIR2, SIR2L1, SIR2alpha
• NCBI Gene Id: 23411
• Protein Name: NAD-dependent protein deacetylase sirtuin-1
• Description of Target: SIRT1 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined;
• Uniprot ID: Q96EB6
• Protein Accession #: NP_036370
• Nucleotide Accession #: NM_012238
• Protein Size (# AA): 747
• Molecular Weight: 82kDa
• Protein Interactions: SIRT2; KAT5; IRS1; ING2; ING1; HSP90AA1; AR; EP300; CDK1; CCNB1; RPS19BP1; KAT8; CLOCK; IRS2; UBE2I; TP53; STK11; WRN; PPARGC1A; FOXO1; VHL; UBC; E2F1; PSME3; KCNA5; KCNA4; KCNAB2; POP1; PPARA; CAP1; KIAA1598; TPM4; FASN; CDKL1; HIC1; HDAC4; CHD3; CDK6; S