SIRT1 Antibody - N-terminal region (ARP32386_T100)

Catalog No: ARP32386_T100

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

Host: Rabbit
Target Name: SIRT1
Sample Tissue: Human 786-0
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SIRT1
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: PETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKI
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-SIRT1 (ARP32386_T100) antibody is Catalog # AAP32386 (Previous Catalog # AAPP03376)
• Reference: Solomon,J.M., et al., (2006) Mol. Cell. Biol. 26 (1), 28-38
• Publications:

  Ambient temperature influences aging in an annual fish (Nothobranchius rachovii). Aging Cell. 8, 726-37 (2009). 19780720

  Dietary saturated fatty acids reduce hepatic lipid accumulation but induce fibrotic change in alcohol-fed rats. Hepatobiliary Surg Nutr. 4, 172-83 (2015). 26151057

  Late-onset temperature reduction can retard the aging process in aged fish via a combined action of an anti-oxidant system and the insulin/insulin-like growth factor 1 signaling pathway. Rejuvenation Res. 17, 507-17 (2014). 25298234

• Description:
  View product citations for SIRT1 Antibody - N-terminal region (ARP32386_T100) on CiteAb

Target Info

• Gene Symbol: SIRT1
• Gene Full Name: Sirtuin 1
• Alias Symbols: SIR2, SIR2L1, SIR2alpha
• NCBI Gene Id: 23411
• Protein Name: NAD-dependent protein deacetylase sirtuin-1
• Description of Target: SIRT1 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family.
• Uniprot ID: Q96EB6
• Protein Accession #: NP_036370
• Nucleotide Accession #: NM_012238
• Protein Size (# AA): 747
• Molecular Weight: 82kDa
• Protein Interactions: SIRT2; KAT5; IRS1; ING2; ING1; HSP90AA1; AR; EP300; CDK1; CCNB1; RPS19BP1; KAT8; CLOCK; IRS2; UBE2I; TP53; STK11; WRN; PPARGC1A; FOXO1; VHL; UBC; E2F1; PSME3; KCNA5; KCNA4; KCNAB2; POP1; PPARA; CAP1; KIAA1598; TPM4; FASN; CDKL1; HIC1; HDAC4; CHD3; CDK6; S