SIRT1 Antibody - N-terminal region (ARP32386_P050)

• Product Number: ARP32386_P050
• Name: SIRT1 Antibody - N-terminal region (ARP32386_P050)
• Protein Size (# AA): 747 amino acids
• Molecular Weight: 82kDa
• NCBI Gene Id: 23411
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Sirtuin 1
• Alias Symbols: SIR2, SIR2L1, SIR2alpha
• Peptide Sequence: Synthetic peptide located within the following region: PETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Solomon,J.M., et al., (2006) Mol. Cell. Biol. 26 (1), 28-38
• Description of Target: SIRT1 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined;
• Protein Interactions: SIRT2; KAT5; IRS1; ING2; ING1; HSP90AA1; AR; EP300; CDK1; CCNB1; RPS19BP1; KAT8; CLOCK; IRS2; UBE2I; TP53; STK11; WRN; PPARGC1A; FOXO1; VHL; UBC; E2F1; PSME3; KCNA5; KCNA4; KCNAB2; POP1; PPARA; CAP1; KIAA1598; TPM4; FASN; CDKL1; HIC1; HDAC4; CHD3; CDK6; S
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SIRT1 (ARP32386_P050) antibody is Catalog # AAP32386
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SIRT1
• Uniprot ID: Q96EB6
• Protein Name: NAD-dependent protein deacetylase sirtuin-1
• Publications:

  Cueno, M. E., Imai, K., Tamura, M. & Ochiai, K. Butyric acid-induced rat jugular blood cytosolic oxidative stress is associated with SIRT1 decrease. Cell Stress Chaperones. doi:10.1007/s12192-013-0462-7 (2013). 24052229

  Hsu, C.-Y. & Chuang, Y.-L. Changes in Energy-Regulated Molecules in the Trophocytes and Fat Cells of Young and Old Worker Honeybees (Apis mellifera). J. Gerontol. A. Biol. Sci. Med. Sci. (2013). doi:10.1093/gerona/glt163 24149426

  Hsu, C.-Y. & Hu, T.-H. Energy-regulated molecules maintain young status in the trophocytes and fat cells of old queen honeybees. Biogerontology 15, 389-400 (2014). 24973265

  Localization of sirtuins (SIRT1-7) in the aged mouse inner ear. Acta Otolaryngol. 136, 120-31 (2016). 26472659

• Protein Accession #: NP_036370
• Purification: Affinity Purified
• Nucleotide Accession #: NM_012238
• Tested Species Reactivity: Human
• Gene Symbol: SIRT1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
• Image 1: Human capan1, HPAF
  
  Lanes:
  1. 45ug capan1 cell lysate
  2. 45 ug HPAF cell lysate
  Primary Antibody Dilution:
  1:1000
  Secondary Antibody:
  Anti-Rabbit HRP
  Secondary Antibody Dilution:
  1:5000
  Gene Name:
  SIRT1
  Submitted by:
  Dr. Pankaj Singh, UNMC, Omaha, NE
  
• Image 2: Human 786-0
  
  Host: Rabbit
  Target Name: SIRT1
  Sample Tissue: Human 786-0
  Antibody Dilution: 1.0ug/ml
• Image 3: Human Testis
  
  Rabbit Anti-SIRT1 Antibody
  Catalog Number: ARP32386_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue
  Observed Staining: Cytoplasm, Nucleus
  Primary Antibody Concentration: 1:600
  Other Working Concentrations: N/A
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec