website statistics
Account Login 

Aviva Systems Biology office will be closed for Labor Day - 9/5/2016.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

FOXM1 antibody - N-terminal region (ARP30772_P050)

  • Catalog#: ARP30772_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    $289.00
    In Stock

    Conjugation Options

    ARP30772_P050-FITC Conjugated

    ARP30772_P050-HRP Conjugated

    ARP30772_P050-Biotin Conjugated

    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    FOXM1
    NCBI Gene Id:
    2305
    Official Gene Full Name:
    Forkhead box M1
    Protein Name:
    Forkhead box protein M1
    Swissprot Id:
    Q08050
    Protein Accession #:
    NP_973731
    Nucleotide Accession #:
    NM_202002
    Alias Symbols:
    FKHL16, FOXM1B, HFH-11, HFH11, HNF-3, INS-1, MPHOSPH2, MPP-2, MPP2, PIG29, TGT3, TRIDENT
    Replacement Item:
    This antibody may replace item sc-113096 from Santa Cruz Biotechnology.
    Description of Target:
    This protein acts as a Transcriptional activatory factor. May play a role in the control of cell proliferation.
    Protein Size (# AA):
    801
    Molecular Weight:
    88kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    IHC, WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express FOXM1.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express FOXM1.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the N terminal region of human FOXM1
    Species Reactivity:
    Human
    Predicted Homology Based on Immunogen Sequence:
    Human: 100%
    Complete computational species homology data:
    Anti-FOXM1 (ARP30772_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: LKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    SMAD3; FZR1; SUMO1; UBE2I; SP1; CDK2; CCNE1; BANP; OS9; HSP90AA1; CDK6; CDK4; DHX29; ACAT1; CDC27; UBC; BCL6; SUMO2; RB1; CREBBP; CDC25B; CDK1; CCNB1; ZBTB3; CHEK2; STAT3; CDH1; CENPF;
    Blocking Peptide:
    For anti-FOXM1 (ARP30772_P050) antibody is Catalog # AAP30772 (Previous Catalog # AAPP01435)
    Datasheets / Downloads:
    Printable datasheet for anti-FOXM1 (ARP30772_P050) antibody
    Additional Information:
    IHC Information: Western analysis of Jurkat cell lysate.
     
    X
    Ask a Question