website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

FOXM1 antibody - N-terminal region (ARP30772_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul

Regular Price: $289.00

Special Price: $145.00

In Stock

Conjugation Options

ARP30772_P050-FITC Conjugated

ARP30772_P050-HRP Conjugated

ARP30772_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Forkhead box M1
Protein Name:
Forkhead box protein M1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-113096 from Santa Cruz Biotechnology.
Description of Target:
This protein acts as a Transcriptional activatory factor. May play a role in the control of cell proliferation.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOXM1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOXM1.
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXM1
Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-FOXM1 (ARP30772_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FOXM1 (ARP30772_P050) antibody is Catalog # AAP30772 (Previous Catalog # AAPP01435)
Datasheets / Downloads:
Printable datasheet for anti-FOXM1 (ARP30772_P050) antibody
Additional Information:
IHC Information: Western analysis of Jurkat cell lysate.
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...