FOXM1 Peptide - N-terminal region (AAP30772)

Data Sheet
 
Sku AAP30772
Old sku AAPP01435
Price $99.00
Name FOXM1 Peptide - N-terminal region (AAP30772)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene FOXM1
Alias symbols FKHL16, FOXM1B, HFH-11, HFH11, HNF-3, INS-1, MPHOSPH2, MPP-2, MPP2, PIG29, TGT3, TRIDENT
Gene id 2305
Description of target This protein acts as a Transcriptional activatory factor. May play a role in the control of cell proliferation.
Swissprot id Q08050
Protein accession num NP_973731
Nucleotide accession num NM_202002
Protein size 801 amino acids
Molecular weight 88kDa
Species reactivity Human
Application IHC, WB
Peptide sequence LKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
Partner proteins CDK1,CDK2,CREBBP,STAT3,CCNB1,CDH1,CENPF,CHEK2,ZBTB3
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-FOXM1 Antibody(ARP30772_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com