Catalog No: OPCA05079
Price: $0.00
SKU
OPCA05079
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for FOXM1 Recombinant Protein (Human ) (OPCA05079) (OPCA05079) |
---|
Predicted Species Reactivity | Homo sapiens|Human |
---|---|
Product Format | Liquid or Lyophilized powder |
Reconstitution and Storage | -20°C or -80°C |
Purification | Affinity purified using IMAC |
Concentration | Varies by lot. See vial for exact concentration. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL |
Protein Sequence | ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 235-327 aa |
Tag | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Reference | Hepatocyte nuclear factor 3/fork head homolog 11 is expressed in proliferating epithelial and mesenchymal cells of embryonic and adult tissues. Ye H., Kelly T.F., Samadani U., Lim L., Rubio S., Overdier D.G., Roebuck K.A., Costa R.H. Mol. Cell. Biol. 17:1626-1641(1997) |
Gene Symbol | FOXM1 |
---|---|
Gene Full Name | forkhead box M1 |
Alias Symbols | FKHL16;forkhead box M1-D;forkhead box protein M1;Forkhead, drosophila, homolog-like 16;forkhead-related protein FKHL16;FOXM1A;FOXM1B;FOXM1C;hepatocyte nuclear factor 3 forkhead homolog 11;HFH11;HFH-11;HNF-3;HNF-3/fork-head homolog 11;INS-1;M-phase phosphoprotein 2;MPHOSPH2;MPM-2 reactive phosphoprotein 2;MPP2;MPP-2;PIG29;transcription factor Trident;TRIDENT;winged-helix factor from INS-1 cells. |
NCBI Gene Id | 2305 |
Protein Name | Forkhead box protein M1 |
Description of Target | Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response. |
Uniprot ID | Q08050 |
Protein Accession # | NP_001230017 |
Nucleotide Accession # | NM_001243088 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 31.2 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!