Search Antibody, Protein, and ELISA Kit Solutions

FOXM1 Antibody - middle region (ARP39519_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39519_P050-FITC Conjugated

ARP39519_P050-HRP Conjugated

ARP39519_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Forkhead box M1
NCBI Gene Id:
Protein Name:
Forkhead box protein M1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-113096 from Santa Cruz Biotechnology.
Description of Target:
This protein acts as a Transcriptional activatory factor. May play a role in the control of cell proliferation.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOXM1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOXM1.
The immunogen is a synthetic peptide directed towards the middle region of human FOXM1
Predicted Homology Based on Immunogen Sequence:
Dog: 79%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-FOXM1 (ARP39519_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FOXM1 (ARP39519_P050) antibody is Catalog # AAP39519 (Previous Catalog # AAPP21535)
Printable datasheet for anti-FOXM1 (ARP39519_P050) antibody
Target Reference:
Laoukili,J., (2008) Mol. Cell. Biol. 28 (9), 3076-3087

Hu, C. et al. LXR-alpha-mediated downregulation of FOXM1 suppresses the proliferation of hepatocellular carcinoma cells. Oncogene. 33, 2888-97 (2014). WB, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 23812424

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...