Search Antibody, Protein, and ELISA Kit Solutions

FOXM1 antibody - middle region (ARP39519_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39519_P050-FITC Conjugated

ARP39519_P050-HRP Conjugated

ARP39519_P050-Biotin Conjugated

Gene Symbol:
FOXM1
NCBI Gene Id:
2305
Official Gene Full Name:
Forkhead box M1
Protein Name:
Forkhead box protein M1
Swissprot Id:
Q08050
Protein Accession #:
NP_068772
Nucleotide Accession #:
NM_021953
Alias Symbols:
FKHL16, FOXM1B, HFH-11, HFH11, HNF-3, INS-1, MPHOSPH2, MPP-2, MPP2, PIG29, TGT3, TRIDENT
Replacement Item:
This antibody may replace item sc-113096 from Santa Cruz Biotechnology.
Description of Target:
This protein acts as a Transcriptional activatory factor. May play a role in the control of cell proliferation.
Protein Size (# AA):
763
Molecular Weight:
84kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOXM1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOXM1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human FOXM1
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 79%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-FOXM1 (ARP39519_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SMAD3; FZR1; SUMO1; UBE2I; SP1; CDK2; CCNE1; BANP; OS9; HSP90AA1; CDK6; CDK4; DHX29; ACAT1; CDC27; UBC; BCL6; SUMO2; RB1; CREBBP; CDC25B; CDK1; CCNB1; ZBTB3; CHEK2; STAT3; CDH1; CENPF;
Blocking Peptide:
For anti-FOXM1 (ARP39519_P050) antibody is Catalog # AAP39519 (Previous Catalog # AAPP21535)
Datasheets/Manuals:
Printable datasheet for anti-FOXM1 (ARP39519_P050) antibody
Target Reference:
Laoukili,J., (2008) Mol. Cell. Biol. 28 (9), 3076-3087
Publications:

Hu, C. et al. LXR-alpha-mediated downregulation of FOXM1 suppresses the proliferation of hepatocellular carcinoma cells. Oncogene (2013). doi:10.1038/onc.2013.250 WB, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat 23812424

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...