FOXM1 Antibody - N-terminal region (ARP30772_P050)

Data Sheet
 
Product Number ARP30772_P050
Product Page www.avivasysbio.com/foxm1-antibody-n-terminal-region-arp30772-p050.html
Name FOXM1 Antibody - N-terminal region (ARP30772_P050)
Protein Size (# AA) 801 amino acids
Molecular Weight 88kDa
NCBI Gene Id 2305
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Forkhead box M1
Alias Symbols MPP2, HFH11, HNF-3, INS-1, MPP-2, PIG29, FKHL16, FOXM1A, FOXM1B, FOXM1C, HFH-11, TRIDENT, MPHOSPH2
Peptide Sequence Synthetic peptide located within the following region: LKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This protein acts as a Transcriptional activatory factor. May play a role in the control of cell proliferation.
Protein Interactions SMAD3; FZR1; SUMO1; UBE2I; SP1; CDK2; CCNE1; BANP; OS9; HSP90AA1; CDK6; CDK4; DHX29; ACAT1; CDC27; UBC; BCL6; SUMO2; RB1; CREBBP; CDC25B; CDK1; CCNB1; ZBTB3; CHEK2; STAT3; CDH1; CENPF;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FOXM1 (ARP30772_P050) antibody
Additional Information IHC Information: Immunohistochemistry of formalin-fixed, paraffin-embedded human spleen tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Blocking Peptide For anti-FOXM1 (ARP30772_P050) antibody is Catalog # AAP30772 (Previous Catalog # AAPP01435)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FOXM1
Uniprot ID Q08050
Protein Name Forkhead box protein M1
Protein Accession # NP_973731
Purification Affinity Purified
Nucleotide Accession # NM_202002
Tested Species Reactivity Human
Gene Symbol FOXM1
Predicted Species Reactivity Human
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human THP-1
WB Suggested Anti-FOXM1 Antibody Titration: 1 ug/ml
Positive Control: THP-1 cell lysate
Image 2
Human spleen
Immunohistochemistry of formalin-fixed, paraffin-embedded human spleen tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com