LEP Antibody - middle region (ARP41698_P050)

Catalog No: ARP41698_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/mL of the antibody was used in this experiment.

WB Suggested Anti-LEP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysateLEP is supported by BioGPS gene expression data to be expressed in HepG2

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Additional Information: IHC Information: Pancreas
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LEP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 86%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%; Sheep: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LEP (ARP41698_P050) antibody is Catalog # AAP41698 (Previous Catalog # AAPP24341)
• Sample Type Confirmation:

  LEP is supported by BioGPS gene expression data to be expressed in HepG2

• Enhanced Validation:

  Relative Expression (Western Blot)

• Reference: Souren,N.Y., (er) Int J Obes (Lond) (2008) In press
• Publications:

  Proteomic Analysis of Plasma Reveals Fat Mass Influences Cancer-Related Pathways in Healthy Humans Fed Controlled Diets Differing in Glycemic Load. Cancer Prev Res (Phila). 12, 567-578 (2019). 31266826

• Description:
  View product citations for LEP Antibody - middle region (ARP41698_P050) on CiteAb

Target Info

• Gene Symbol: LEP
• Gene Full Name: leptin
• Alias Symbols: OB, OBS, LEPD
• NCBI Gene Id: 3952
• Protein Name: leptin
• Description of Target: This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathways that inhibit feeding and promote energy expenditure. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation and wound healing. Mutations in this gene and its regulatory regions cause severe obesity and morbid obesity with hypogonadism in human patients. A mutation in this gene has also been linked to type 2 diabetes mellitus development.
• Uniprot ID: P41159
• Protein Accession #: NP_000221
• Nucleotide Accession #: NM_000230
• Protein Size (# AA): 167
• Molecular Weight: 19 kDa
• Protein Interactions: Hk3; SIGLEC6; GHRL; LEPR; UCN; PRKAA2; CLU; CRP; A2M; STAT3;