website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

ADRB2 antibody - middle region (AVARP00006_P050)

Description of Target:
This protein is beta-2-adrenergic receptor which is a member of the G protein-coupled receptor superfamily. This receptor is directly associated with one of its ultimate effectors, the class C L-type calcium channel Ca(V)1.2. This receptor-channel complex also contains a G protein, an adenylyl cyclase, cAMP-dependent kinase, and the counterbalancing phosphatase, PP2A. The assembly of the signaling complex provides a mechanism that ensures specific and rapid signaling by this G protein-coupled receptor. This gene encodes beta-2-adrenergic receptor which is a member of the G protein-coupled receptor superfamily. This receptor is directly associated with one of its ultimate effectors, the class C L-type calcium channel Ca(V)1.2. This receptor-channel complex also contains a G protein, an adenylyl cyclase, cAMP-dependent kinase, and the counterbalancing phosphatase, PP2A. The assembly of the signaling complex provides a mechanism that ensures specific and rapid signaling by this G protein-coupled receptor. This gene is intronless. Different polymorphic forms, point mutations, and/or downregulation of this gene are associated with nocturnal asthma, obesity and type 2 diabetes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
ADRB2
Official Gene Full Name:
Adrenergic, beta-2-, receptor, surface
NCBI Gene Id:
154
Alias Symbols:
ADRB2R; ADRBR; B2AR; BAR; BETA2AR
Tissue Tool:
Find tissues and cell lines supported to express ADRB2.
Protein Accession #:
NP_000015
Nucleotide Accession#:
NM_000024
Swissprot Id:
P07550
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Beta-2 adrenergic receptor
Protein Size (# AA):
413
Molecular Weight:
46kDa
Application:
WB
Partner Proteins:
HHV4gp086, APEX1, AURKA, GORASP2, ITGB1, KSR1, MIF, NME1, NME3, NME4, POLR1C, PRUNE, RORA, RORB, RRAD, SET, TERF1, TIAM1, WDYHV1, AURKA, GORASP2, ITGB1, NME1, NME3, NME4, POLR1C, PRUNE, RAC1, RORA, RORB, RRAD, SET, TERF1, TIAM1, USP18, WDYHV1
Immunogen:
The immunogen for anti-ADRB2 antibody: synthetic peptide directed towards the middle region of human ADRB2
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
ADRB2 antibody - middle region (AVARP00006_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Human
Datasheets / Downloads:
Printable datasheet for
anti-ADRB2 antibody
- AVARP00006_P050
Peptide Sequence:
Synthetic peptide located within the following region: TGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTN
Blocking Peptide:
For anti-ADRB2 antibody is Catalog # AAP30422 (Previous Catalog # AAPP01005)
Key Reference:
Penco,S., (er) BMC Bioinformatics 9 (1), 254 (2008) In press
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-ADRB2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question