website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ADRB2 antibody - middle region (AVARP00006_P050)

  • Catalog#: AVARP00006_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    ADRB2
    NCBI Gene Id:
    154
    Official Gene Full Name:
    Adrenergic, beta-2-, receptor, surface
    Protein Name:
    Beta-2 adrenergic receptor
    Swissprot Id:
    P07550
    Protein Accession #:
    NP_000015
    Nucleotide Accession #:
    NM_000024
    Alias Symbols:
    ADRB2R, ADRBR, B2AR, BAR, BETA2AR
    Description of Target:
    This protein is beta-2-adrenergic receptor which is a member of the G protein-coupled receptor superfamily. This receptor is directly associated with one of its ultimate effectors, the class C L-type calcium channel Ca(V)1.2. This receptor-channel complex also contains a G protein, an adenylyl cyclase, cAMP-dependent kinase, and the counterbalancing phosphatase, PP2A. The assembly of the signaling complex provides a mechanism that ensures specific and rapid signaling by this G protein-coupled receptor. This gene encodes beta-2-adrenergic receptor which is a member of the G protein-coupled receptor superfamily. This receptor is directly associated with one of its ultimate effectors, the class C L-type calcium channel Ca(V)1.2. This receptor-channel complex also contains a G protein, an adenylyl cyclase, cAMP-dependent kinase, and the counterbalancing phosphatase, PP2A. The assembly of the signaling complex provides a mechanism that ensures specific and rapid signaling by this G protein-coupled receptor. This gene is intronless. Different polymorphic forms, point mutations, and/or downregulation of this gene are associated with nocturnal asthma, obesity and type 2 diabetes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
    Protein Size (# AA):
    413
    Molecular Weight:
    46kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express ADRB2.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express ADRB2.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the middle region of human ADRB2
    Species Reactivity:
    Human
    Predicted Homology Based on Immunogen Sequence:
    Human: 100%
    Complete computational species homology data:
    Anti-ADRB2 (AVARP00006_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: TGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTN
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    ARRDC3; REL; TSHR; TSG101; STAT4; STAT3; SNCG; RGS10; RGS2; RAN; RAB27A; RAB3A; CNN1; CD81; CD68; CD9; CD4; CCKBR; CEACAM1; ARRB2; ARHGDIA; ARHGAP5; HDAC6; GPR56; VAPA; RGS9; RGS11; RGS20; RGS5; VEGFB; VDAC2; VDAC1; KCTD13; ARRDC1; RGS8; SLC52A2; WNK1; RA
    Blocking Peptide:
    For anti-ADRB2 (AVARP00006_P050) antibody is Catalog # AAP30422 (Previous Catalog # AAPP01005)
    Datasheets / Downloads:
    Printable datasheet for anti-ADRB2 (AVARP00006_P050) antibody
    Target Reference:
    Penco,S., (er) BMC Bioinformatics 9 (1), 254 (2008) In press

    Product Protocols: ADRB2 antibody tested with Human Ovcar-3 Cells (AVARP00006_P050)

    Aviva Systems Biology is the original manufacturer of this ADRB2 antibody (AVARP00006_P050)

    Click here to view the ADRB2 antibody Western Blot Protocol

    Product Datasheet Link: ADRB2 antibody (AVARP00006_P050)

    WB Suggested Anti-ADRB2 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:62500
    Positive Control: OVCAR-3

    Western Blot image:


    Description of Target: This protein is beta-2-adrenergic receptor which is a member of the G protein-coupled receptor superfamily. This receptor is directly associated with one of its ultimate effectors, the class C L-type calcium channel Ca(V)1.2. This receptor-channel complex also contains a G protein, an adenylyl cyclase, cAMP-dependent kinase, and the counterbalancing phosphatase, PP2A. The assembly of the signaling complex provides a mechanism that ensures specific and rapid signaling by this G protein-coupled receptor. This gene encodes beta-2-adrenergic receptor which is a member of the G protein-coupled receptor superfamily. This receptor is directly associated with one of its ultimate effectors, the class C L-type calcium channel Ca(V)1.2. This receptor-channel complex also contains a G protein, an adenylyl cyclase, cAMP-dependent kinase, and the counterbalancing phosphatase, PP2A. The assembly of the signaling complex provides a mechanism that ensures specific and rapid signaling by this G protein-coupled receptor. This gene is intronless. Different polymorphic forms, point mutations, and/or downregulation of this gene are associated with nocturnal asthma, obesity and type 2 diabetes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s ADRB2 antibody (AVARP00006_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question