TNFRSF13C Antibody - C-terminal region (ARP63621_P050)

Catalog No: ARP63621_P050

WB Suggested Anti-TNFRSF13C Antibody
Titration: 1.0 ug/ml
Positive Control: 721_B Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TNFRSF13C (ARP63621_P050) antibody is Catalog # AAP63621

Target Info

• Gene Symbol: TNFRSF13C
• Gene Full Name: Tumor necrosis factor receptor superfamily, member 13C
• Alias Symbols: BAFFR, CD268, CVID4, BAFF-R, BROMIX, prolixin
• NCBI Gene Id: 115650
• Protein Name: Tumor necrosis factor receptor superfamily member 13C
• Description of Target: B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival.
• Uniprot ID: Q96RJ3
• Protein Accession #: NP_443177
• Nucleotide Accession #: NM_052945
• Protein Size (# AA): 184
• Molecular Weight: 20kDa
• Protein Interactions: TNFSF13B; TRAF3IP2; TRAF3; TRAF2; TRAF1; TNFRSF13C;