PRF1 Antibody - N-terminal region (ARP42208_P050)

Catalog No: ARP42208_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRF1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 77%; Dog: 92%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Pig: 100%; Rabbit: 92%; Rat: 77%
• Peptide Sequence: Synthetic peptide located within the following region: SVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PRF1 (ARP42208_P050) antibody is Catalog # AAP42208 (Previous Catalog # AAPP24631)
• Reference: Okur,H., (2008) Leuk. Res. 32 (6), 972-975

Target Info

• Gene Symbol: PRF1
• Gene Full Name: Perforin 1 (pore forming protein)
• Alias Symbols: P1, PFP, HPLH2
• NCBI Gene Id: 5551
• Protein Name: Perforin-1
• Description of Target: PRF1 has structural and functional similarities to complement component 9 (C9). Like C9, this protein creates transmembrane tubules and is capable of lysing non-specifically a variety of target cells. This protein is one of the main cytolytic proteins of cytolytic granules, and it is known to be a key effector molecule for T-cell- and natural killer-cell-mediated cytolysis. Defects in the gene encoding PRF1 cause familial hemophagocytic lymphohistiocytosis type 2 (HPLH2), a rare and lethal autosomal recessive disorder of early childhood. The protein encoded by this gene has structural and functional similarities to complement component 9 (C9). Like C9, this protein creates transmembrane tubules and is capable of lysing non-specifically a variety of target cells. This protein is one of the main cytolytic proteins of cytolytic granules, and it is known to be a key effector molecule for T-cell- and natural killer-cell-mediated cytolysis. Defects in this gene cause familial hemophagocytic lymphohistiocytosis type 2 (HPLH2), a rare and lethal autosomal recessive disorder of early childhood. Alternative splicing results in multiple transcript variants encoding the same protein.
• Uniprot ID: P14222
• Protein Accession #: NP_005032
• Nucleotide Accession #: NM_005041
• Protein Size (# AA): 555
• Molecular Weight: 61 kDa
• Protein Interactions: KRT31; FBXO6; PRF1; TRIM54; DDX24; GZMB; CALR;