SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP54321_P050
Price: $0.00
SKU
ARP54321_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-IL1A (ARP54321_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Goat, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human IL1A
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceGoat: 79%; Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 83%
Peptide SequenceSynthetic peptide located within the following region: VPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVS
Concentration0.5 mg/ml
Blocking PeptideFor anti-IL1A (ARP54321_P050) antibody is Catalog # AAP54321
ReferenceN/A
Gene SymbolIL1A
Gene Full Nameinterleukin 1, alpha
Alias SymbolsIL1, IL-1A, IL1F1, IL1-ALPHA, IL-1 alpha
NCBI Gene Id3552
Protein NameInterleukin-1 alpha
Description of TargetThe protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.
Uniprot IDP01583
Protein Accession #NP_000566
Protein Size (# AA)271
Molecular Weight29kDa
  1. What is the species homology for "IL1A Antibody - N-terminal region (ARP54321_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Goat, Rabbit".

  2. How long will it take to receive "IL1A Antibody - N-terminal region (ARP54321_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "IL1A Antibody - N-terminal region (ARP54321_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "IL1A Antibody - N-terminal region (ARP54321_P050)"?

    This target may also be called "IL1, IL-1A, IL1F1, IL1-ALPHA, IL-1 alpha" in publications.

  5. What is the shipping cost for "IL1A Antibody - N-terminal region (ARP54321_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IL1A Antibody - N-terminal region (ARP54321_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IL1A Antibody - N-terminal region (ARP54321_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "29kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IL1A Antibody - N-terminal region (ARP54321_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "IL1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IL1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IL1A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IL1A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IL1A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IL1A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IL1A Antibody - N-terminal region (ARP54321_P050)
Your Rating
We found other products you might like!