- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-MAF (ARP38608_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Horse |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human MAF |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Horse: 93%; Human: 100% |
Peptide Sequence | Synthetic peptide located within the following region: DAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWK |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-MAF (ARP38608_P050) antibody is Catalog # AAP38608 |
Gene Symbol | MAF |
---|---|
Gene Full Name | v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) |
Alias Symbols | CCA4, AYGRP, c-MAF, CTRCT21 |
NCBI Gene Id | 4094 |
Protein Name | Transcription factor Maf |
Description of Target | The protein encoded by this gene is a DNA-binding, leucine zipper-containing transcription factor that acts as a homodimer or as a heterodimer. Depending on the binding site and binding partner, the encoded protein can be a transcriptional activator or repressor. This protein plays a role in the regulation of several cellular processes, including embryonic lens fiber cell development, increased T-cell susceptibility to apoptosis, and chondrocyte terminal differentiation. Defects in this gene are a cause of juvenile-onset pulverulent cataract as well as congenital cerulean cataract 4 (CCA4). Two transcript variants encoding different isoforms have been found for this gene. |
Uniprot ID | O75444-1 |
Protein Accession # | NP_005351 |
Nucleotide Accession # | NM_005360 |
Protein Size (# AA) | 403 |
Molecular Weight | 42kDa |
Protein Interactions | MAFB; FOSL1; MAF; FOS; ATF4; AHR; SUMO1; UBE2I; PML; SIN3A; HDAC2; SMARCA5; CEBPA; KDM5B; MAFA; SOX9; EP300; MAFG; USF2; CREBBP; MYB; JUN; ETS1; HOXD12; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "MAF Antibody - C-terminal region (ARP38608_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Horse".
-
How long will it take to receive "MAF Antibody - C-terminal region (ARP38608_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "MAF Antibody - C-terminal region (ARP38608_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "MAF Antibody - C-terminal region (ARP38608_P050)"?
This target may also be called "CCA4, AYGRP, c-MAF, CTRCT21" in publications.
-
What is the shipping cost for "MAF Antibody - C-terminal region (ARP38608_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "MAF Antibody - C-terminal region (ARP38608_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "MAF Antibody - C-terminal region (ARP38608_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "42kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "MAF Antibody - C-terminal region (ARP38608_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "MAF"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "MAF"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "MAF"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "MAF"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "MAF"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "MAF"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.