Loading...
Catalog No: P100617_P050
Price: $0.00
SKU
P100617_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MAF (P100617_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MAF
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 78%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: LQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFI
Concentration0.5 mg/ml
Blocking PeptideFor anti-MAF (P100617_P050) antibody is Catalog # AAP30933 (Previous Catalog # AAPP01657)
ReferenceGosmain,Y., (2007) J. Biol. Chem. 282 (48), 35024-35034
Description
Gene SymbolMAF
Gene Full NameV-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian)
Alias SymbolsCCA4, AYGRP, c-MAF, CTRCT21
NCBI Gene Id4094
Protein NameTranscription factor Maf
Description of TargetMAF acts as a transcriptional activator or repressor. It is involved in embryonic lens fiber cell development. It recruits the transcriptional coactivators CREBBP and/or EP300 to crystallin promoters leading to up-regulation of crystallin gene during lens fiber cell differentiation. MAF is also involved in the initial chondrocyte terminal differentiation and the disappearance of hypertrophic chondrocytes during endochondral bone development. When overexpressed, MAF represses anti-oxidant reponse element (ARE)-mediated transcription. It may be involved either as an oncogene or as a tumor suppressor, depending on the cell context.
Uniprot IDO75444-1
Protein Accession #NP_005351
Nucleotide Accession #NM_005360
Protein Size (# AA)403
Molecular Weight42kDa
Protein InteractionsMAFB; FOSL1; MAF; FOS; ATF4; AHR; SUMO1; UBE2I; PML; SIN3A; HDAC2; SMARCA5; CEBPA; KDM5B; MAFA; SOX9; EP300; MAFG; USF2; CREBBP; MYB; JUN; ETS1; HOXD12;
  1. What is the species homology for "MAF Antibody - middle region (P100617_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish".

  2. How long will it take to receive "MAF Antibody - middle region (P100617_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MAF Antibody - middle region (P100617_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MAF Antibody - middle region (P100617_P050)"?

    This target may also be called "CCA4, AYGRP, c-MAF, CTRCT21" in publications.

  5. What is the shipping cost for "MAF Antibody - middle region (P100617_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MAF Antibody - middle region (P100617_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MAF Antibody - middle region (P100617_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MAF Antibody - middle region (P100617_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MAF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MAF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MAF"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MAF"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MAF"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MAF"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MAF Antibody - middle region (P100617_P050)
Your Rating
We found other products you might like!