website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

GAN antibody - middle region (ARP58470_P050)

Description of Target:
This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN).
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Alias Symbols:
FLJ38059; GAN1; KLHL16
Tissue Tool:
Find tissues and cell lines supported to express GAN.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-GAN antibody: synthetic peptide directed towards the middle region of human GAN
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
GAN antibody - middle region (ARP58470_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Bovine, Human, Rat, Dog, Pig, Horse, Mouse, Rabbit, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-GAN antibody
- ARP58470_P050
Peptide Sequence:
Synthetic peptide located within the following region: IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG
Blocking Peptide:
For anti-GAN antibody is Catalog # AAP58470 (Previous Catalog # AAPP34695)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-GAN antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question