website statistics
Account Login 

Aviva Systems Biology office will be closed for Labor Day - 9/7/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

GAN antibody - middle region (ARP58470_P050)

Description of Target:
This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN).
Gene Symbol:
GAN
Official Gene Full Name:
Gigaxonin
NCBI Gene Id:
8139
Alias Symbols:
FLJ38059; GAN1; KLHL16
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GAN.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GAN.
Swissprot Id:
Q9H2C0
Protein Accession #:
NP_071324
Nucleotide Accession #:
NM_022041
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Gigaxonin
Protein Size (# AA):
597
Molecular Weight:
66kDa
Application:
WB
Protein Interactions:
RELA; HSP90AA1; CUL3; UBA1; TBCB; UBC; ATG16L1; RBX1; MAP1B; SFN;
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human GAN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-GAN (ARP58470_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Species Reactivity:
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat
Datasheets / Downloads:
Printable datasheet for anti-GAN (ARP58470_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG
Blocking Peptide:
For anti-GAN (ARP58470_P050) antibody is Catalog # AAP58470 (Previous Catalog # AAPP34695)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: GAN antibody tested with Human Thp-1 Cells (ARP58470_P050)

Aviva Systems Biology is the original manufacturer of this GAN antibody (ARP58470_P050)

Click here to view the GAN antibody Western Blot Protocol

Product Datasheet Link: GAN antibody (ARP58470_P050)

WB Suggested Anti-GAN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1

Western Blot image:


Description of Target: This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN).

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s GAN antibody (ARP58470_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question