website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

GAN antibody - middle region (ARP58470_P050)

Description of Target:
This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN).
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Alias Symbols:
FLJ38059; GAN1; KLHL16
Tissue Tool:
Find tissues and cell lines supported to express GAN.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-GAN antibody: synthetic peptide directed towards the middle region of human GAN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
GAN antibody - middle region (ARP58470_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Bovine, Human, Rat, Dog, Pig, Horse, Mouse, Rabbit, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-GAN antibody
- ARP58470_P050
Peptide Sequence:
Synthetic peptide located within the following region: IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG
Blocking Peptide:
For anti-GAN antibody is Catalog # AAP58470 (Previous Catalog # AAPP34695)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for GAN antibody (ARP58470)

Product page for GAN antibody (ARP58470)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog gan antibody; Xenopus laevis gan antibody Q66KI4 92%
African elephant GAN antibody; Loxodonta africana GAN antibody G3TAQ3 100%
Bovine GAN antibody; Bos taurus GAN antibody A6H7J3 100%
Chicken GAN antibody; Gallus gallus GAN antibody F1NH29 100%
Common turkey GAN antibody; Meleagris gallopavo GAN antibody G1N4U1 100%
Dog GAN antibody; Canis familiaris GAN antibody E2RQK0 100%
Gray short-tailed opossum GAN antibody; Monodelphis domestica GAN antibody F6V4G7 100%
Guinea pig LOC100726340 antibody; Cavia porcellus LOC100726340 antibody H0VGE5 100%
Horse GAN antibody; Equus caballus GAN antibody F6T7B9 100%
Human GAN antibody; Homo sapiens GAN antibody Q9H2C0 100%
Human GAN antibody; Homo sapiens GAN antibody B3KTC3 100%
Little brown bat GAN antibody; Myotis lucifugus GAN antibody G1PR18 100%
Lowland gorilla GAN antibody; Gorilla gorilla gorilla GAN antibody G3RE91 100%
Mouse GAN antibody; Mus musculus GAN antibody Q8CA72 100%
Mouse Gan antibody; Mus musculus Gan antibody F6TZU3 100%
Northern white-cheeked gibbon GAN antibody; Nomascus leucogenys GAN antibody G1RI91 100%
Pig GAN antibody; Sus scrofa GAN antibody F1S473 100%
Rabbit GAN antibody; Oryctolagus cuniculus GAN antibody G1SEP2 100%
Rat Gan antibody; Rattus norvegicus Gan antibody D3ZRI9 100%
Rhesus macaque GAN antibody; Macaca mulatta GAN antibody F6V530 100%
Small-eared galago GAN antibody; Otolemur garnettii GAN antibody H0X712 100%
Tasmanian devil GAN antibody; Sarcophilus harrisii GAN antibody G3W2J2 100%
Western clawed frog gan antibody; Xenopus tropicalis gan antibody F6WU31 92%
Western clawed frog gan antibody; Xenopus tropicalis gan antibody B7ZTY6 92%
Western clawed frog gan antibody; Xenopus tropicalis gan antibody Q28CU8 85%
White-tufted-ear marmoset GAN antibody; Callithrix jacchus GAN antibody F6YPB4 100%
Zebra finch GAN antibody; Taeniopygia guttata GAN antibody H0Z242 100%

Product Protocols: GAN antibody tested with Human Thp-1 Cells (ARP58470_P050)

Aviva Systems Biology is the original manufacturer of this GAN antibody (ARP58470_P050)

Click here to view the GAN antibody Western Blot Protocol

Product Datasheet Link: GAN antibody (ARP58470_P050)

WB Suggested Anti-GAN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1

Western Blot image:

Description of Target: This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN).

Questions pertaining to this data can be directed to

Aviva Systems Biology’s GAN antibody (ARP58470_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question