Sku |
AAP58470 |
Old sku |
AAPP34695 |
Price |
$99.00 |
Name |
GAN Peptide - middle region (AAP58470) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
GAN |
Alias symbols |
FLJ38059, GAN1, KLHL16 |
Gene id |
8139 |
Description of target |
This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN). |
Swissprot id |
Q9H2C0 |
Protein accession num |
NP_071324 |
Nucleotide accession num |
NM_022041 |
Protein size |
597 amino acids |
Molecular weight |
66kDa |
Species reactivity |
Human |
Application |
WB |
Peptide sequence |
IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG |
Partner proteins |
MAP1B,TBCB,UBA1,ATG16L1,CUL3,MAP1B,RBX1,SFN,UBC |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-GAN Antibody(ARP58470_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |