GAN Antibody - middle region (ARP58470_P050)

Data Sheet
 
Product Number ARP58470_P050
Product Page www.avivasysbio.com/gan-antibody-middle-region-arp58470-p050.html
Name GAN Antibody - middle region (ARP58470_P050)
Protein Size (# AA) 597 amino acids
Molecular Weight 66kDa
NCBI Gene Id 8139
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Gigaxonin
Alias Symbols GIG, GAN1, KLHL16
Peptide Sequence Synthetic peptide located within the following region: IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN).
Protein Interactions RELA; HSP90AA1; CUL3; UBA1; TBCB; UBC; ATG16L1; RBX1; MAP1B; SFN;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GAN (ARP58470_P050) antibody
Blocking Peptide For anti-GAN (ARP58470_P050) antibody is Catalog # AAP58470 (Previous Catalog # AAPP34695)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GAN
Uniprot ID Q9H2C0
Protein Name Gigaxonin
Protein Accession # NP_071324
Purification Affinity Purified
Nucleotide Accession # NM_022041
Tested Species Reactivity Human
Gene Symbol GAN
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human THP-1
WB Suggested Anti-GAN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com