TM6SF2 Antibody - C-terminal region (ARP44400_P050)

Catalog No: ARP44400_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 5 ug/mL of the antibody was used in this experiment. Several isoforms contain the peptide sequence including ~150 kDa and smaller isoforms from 23 to 53 kDa.

Host: Rabbit
Target Name: TM6SF2
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0ug/ml

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TM6SF2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 75%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: FFTLFRGLVVLDCPTDACFVYIYQYEPYLRDPVAYPKVQMLMYMFYVLPF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TM6SF2 (ARP44400_P050) antibody is Catalog # AAP44400
• Enhanced Validation:

  Relative Expression (Western Blot)

• Publications:

  Holmen, O. L. et al. Systematic evaluation of coding variation identifies a candidate causal variant in TM6SF2 influencing total cholesterol and myocardial infarction risk. Nat. Genet. 46, 345-51 (2014). 24633158

  Sookoian, S. et al. Genetic variation in TM6SF2 and the risk of nonalcoholic fatty liver disease and histological disease severity. Hepatology (2014). doi:10.1002/hep.27556 25302781

Target Info

• Gene Symbol: TM6SF2
• Gene Full Name: transmembrane 6 superfamily member 2
• NCBI Gene Id: 53345
• Protein Name: Transmembrane 6 superfamily member 2
• Description of Target: The function of this protein remains unknown.
• Uniprot ID: Q9BZW4-2
• Protein Size (# AA): 377
• Molecular Weight: 43 kDa