website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TSHR antibody - C-terminal region (ARP41871_P050)

Description of Target:
TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).
Gene Symbol:
Official Gene Full Name:
Thyroid stimulating hormone receptor
NCBI Gene Id:
Alias Symbols:
LGR3; MGC75129; hTSHR-I; CHNG1
Sample Type Confirmation:

There is BioGPS gene expression data showing that TSHR is expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported to express TSHR.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Thyrotropin receptor
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-TSHR antibody: synthetic peptide directed towards the C terminal of human TSHR
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
TSHR antibody - C-terminal region (ARP41871_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Pig: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Bovine: 83%; Sheep: 79%
Species Reactivity:
Human, Horse, Rat, Dog, Rabbit, Guinea pig, Mouse, Bovine, Sheep
Datasheets / Downloads:
Printable datasheet for
anti-TSHR antibody
- ARP41871_P050
Peptide Sequence:
Synthetic peptide located within the following region: KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS
Blocking Peptide:
For anti-TSHR antibody is Catalog # AAP41871 (Previous Catalog # AAPP24408)
Target Reference:
Claus,M., (2005) Endocrinology 146 (12), 5197-5203
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TSHR antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for TSHR antibody (ARP41871)

Product page for TSHR antibody (ARP41871)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant LOC100659046 antibody; Loxodonta africana LOC100659046 antibody G3SMY9 92%
Bovine Bt.34 antibody; Bos taurus Bt.34 antibody F1N0T2 83%
Bovine TSHR antibody; Bos taurus TSHR antibody Q27987 83%
Bovine TSHR antibody; Bos taurus TSHR antibody Q27987-2 83%
Bovine TSHR antibody; Bos taurus TSHR antibody F1N4F6 83%
Cat TSHR antibody; Felis catus TSHR antibody Q9BGN4 85%
Dog Cfa.3837 antibody; Canis familiaris Cfa.3837 antibody F1PJI9 92%
Dog Cfa.3837 antibody; Canis familiaris Cfa.3837 antibody F1PJI8 92%
Dog TSHR antibody; Canis familiaris TSHR antibody P14763 92%
Dog TSHR antibody; Canis familiaris TSHR antibody P14763-2 92%
Giant panda LOC100476960 antibody; Ailuropoda melanoleuca LOC100476960 antibody G1L531 92%
Golden hamster tshr antibody; Mesocricetus auratus tshr antibody C9K6U9 92%
Green monkey TSHR antibody; Chlorocebus aethiops TSHR antibody Q8HY54 100%
Guinea pig TSHR antibody; Cavia porcellus TSHR antibody H0UYT1 85%
Horse TSHR antibody; Equus caballus TSHR antibody F6VJS7 92%
Horse TSHR antibody; Equus caballus TSHR antibody B3VP19 92%
Human TSHR antibody; Homo sapiens TSHR antibody P16473 100%
Human TSHR antibody; Homo sapiens TSHR antibody P16473-2 100%
Human TSHR antibody; Homo sapiens TSHR antibody Q59GA2 100%
Human TSHR antibody; Homo sapiens TSHR antibody Q0VAP8 100%
Human TSHR antibody; Homo sapiens TSHR antibody G3V2A9 100%
Human TSHR antibody; Homo sapiens TSHR antibody F5GYU5 100%
Human TSHR antibody; Homo sapiens TSHR antibody A0PJU7 100%
Little brown bat TSHR antibody; Myotis lucifugus TSHR antibody G1PWG0 85%
Lowland gorilla TSHR antibody; Gorilla gorilla gorilla TSHR antibody G3RR76 100%
Lowland gorilla TSHR antibody; Gorilla gorilla gorilla TSHR antibody G3QZE9 100%
Mouse TSHR antibody; Mus musculus TSHR antibody P47750 85%
Mouse Tshr antibody; Mus musculus Tshr antibody Q78U67 85%
Northern white-cheeked gibbon TSHR antibody; Nomascus leucogenys TSHR antibody G1S4L3 100%
Pig TSHR antibody; Sus scrofa TSHR antibody Q8SPP9 85%
Pig TSHR antibody; Sus scrofa TSHR antibody Q8SPP9-2 85%
Rabbit TSHR antibody; Oryctolagus cuniculus TSHR antibody G1SFA5 85%
Rat TSHR antibody; Rattus norvegicus TSHR antibody P21463 92%
Rat Tshr antibody; Rattus norvegicus Tshr antibody G3V6J1 92%
Rat Tshr antibody; Rattus norvegicus Tshr antibody F1LQA3 92%
Rat Tshr antibody; Rattus norvegicus Tshr antibody D3ZGR1 92%
Rhesus macaque Mmu.3677 antibody; Macaca mulatta Mmu.3677 antibody F7BD84 100%
Rhesus macaque Mmu.3677 antibody; Macaca mulatta Mmu.3677 antibody F7BD66 100%
Rhesus macaque TSHR antibody; Macaca mulatta TSHR antibody Q8HY53 100%
Sheep TSHR antibody; Ovis aries TSHR antibody P56495 78%
Small-eared galago TSHR antibody; Otolemur garnettii TSHR antibody H0XQS5 92%
White-tufted-ear marmoset TSHR antibody; Callithrix jacchus TSHR antibody F7HW35 92%
White-tufted-ear marmoset TSHR antibody; Callithrix jacchus TSHR antibody F7HW25 92%
White-tufted-ear marmoset TSHR antibody; Callithrix jacchus TSHR antibody F7H248 92%
White-tufted-ear marmoset TSHR antibody; Callithrix jacchus TSHR antibody F7G9W2 92%

Product Protocols: TSHR antibody tested with Human Jurkat Cells (ARP41871_P050)

Aviva Systems Biology is the original manufacturer of this TSHR antibody (ARP41871_P050)

Click here to view the TSHR antibody Western Blot Protocol

Product Datasheet Link: TSHR antibody (ARP41871_P050)

WB Suggested Anti-TSHR Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:

Description of Target: TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).

Questions pertaining to this data can be directed to

Aviva Systems Biology’s TSHR antibody (ARP41871_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question