website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

TSHR antibody - C-terminal region (ARP41871_P050)

Description of Target:
TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).
Gene Symbol:
TSHR
Official Gene Full Name:
Thyroid stimulating hormone receptor
NCBI Gene Id:
7253
Alias Symbols:
LGR3; MGC75129; hTSHR-I; CHNG1
Sample Type Confirmation:

There is BioGPS gene expression data showing that TSHR is expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported to express TSHR.
Protein Accession #:
NP_001018046
Nucleotide Accession#:
NM_001018036
Swissprot Id:
Q96GT6
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Thyrotropin receptor
Protein Size (# AA):
253
Molecular Weight:
28kDa
Application:
WB
Protein Interactions:
ADRB2; SCRIB; UBC; TSHB; RABAC1; GNA13; GNA12; FLNB; TSHR; GNAQ; PIK3R1; LHCGR; JAK2; JAK1; GNAI3; GNAI2; GNAS; GNA11; GNAO1; GNAI1; HSPA5; FN1; CANX; CALR; STAT3; CALCR;
Immunogen:
The immunogen for anti-TSHR antibody: synthetic peptide directed towards the C terminal of human TSHR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
TSHR antibody - C-terminal region (ARP41871_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Pig: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Bovine: 83%; Sheep: 79%
Species Reactivity:
Human, Horse, Rat, Dog, Rabbit, Guinea pig, Mouse, Bovine, Sheep
Datasheets / Downloads:
Printable datasheet for
anti-TSHR antibody
- ARP41871_P050
Peptide Sequence:
Synthetic peptide located within the following region: KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS
Blocking Peptide:
For anti-TSHR antibody is Catalog # AAP41871 (Previous Catalog # AAPP24408)
Target Reference:
Claus,M., (2005) Endocrinology 146 (12), 5197-5203
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Publications:

Pessina, P., Castillo, V., Sartore, I., Borrego, J. & Meikle, A. Semiquantitative immunohistochemical marker staining and localization in canine thyroid carcinoma and normal thyroid gland. Vet. Comp. Oncol. (2014). doi:10.1111/vco.12111 IHC, Human, Horse, Rat, Dog, Rabbit, Guinea pig, Mouse, Bovine, Sheep 25082554

Product Protocols: TSHR antibody tested with Human Jurkat Cells (ARP41871_P050)

Aviva Systems Biology is the original manufacturer of this TSHR antibody (ARP41871_P050)

Click here to view the TSHR antibody Western Blot Protocol

Product Datasheet Link: TSHR antibody (ARP41871_P050)

WB Suggested Anti-TSHR Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:


Description of Target: TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s TSHR antibody (ARP41871_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question