website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TSHR antibody - C-terminal region (ARP41871_P050)

Description of Target:
TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).
Gene Symbol:
Official Gene Full Name:
Thyroid stimulating hormone receptor
NCBI Gene Id:
Alias Symbols:
LGR3; MGC75129; hTSHR-I; CHNG1
Sample Type Confirmation:

There is BioGPS gene expression data showing that TSHR is expressed in Jurkat

Tissue Tool:
Find tissues and cell lines supported to express TSHR.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Thyrotropin receptor
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-TSHR antibody: synthetic peptide directed towards the C terminal of human TSHR
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
TSHR antibody - C-terminal region (ARP41871_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Pig: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Bovine: 83%; Sheep: 79%
Species Reactivity:
Human, Horse, Rat, Dog, Rabbit, Guinea pig, Mouse, Bovine, Sheep
Datasheets / Downloads:
Printable datasheet for
anti-TSHR antibody
- ARP41871_P050
Peptide Sequence:
Synthetic peptide located within the following region: KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS
Blocking Peptide:
For anti-TSHR antibody is Catalog # AAP41871 (Previous Catalog # AAPP24408)
Key Reference:
Claus,M., (2005) Endocrinology 146 (12), 5197-5203
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TSHR antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question