website statistics

Aviva Systems Biology

Account Login 

Aviva Systems Biology office will be closed on Memorial Day - 5/27/2013.
Please go here for more info.

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
50ug
$289.00
In Stock

RTN4 antibody - middle region (ARP46813_P050)

Description of Target:
RTN4 belongs to the family of reticulons. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. RTN4 is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates.This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified.
Gene Symbol:
RTN4
Official Gene Full Name:
Reticulon 4
Alias Symbols:
ASY; NI220/250; NOGO; NOGO-A; NOGOC; NSP; NSP-CL; Nbla00271; Nbla10545; Nogo-B; Nogo-C; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C
Tissue Tool:
Find tissues and cell lines supported to express RTN4.
Protein Accession# :
NP_008939
Nucleotide Accession#:
NM_007008
Swissprot Id:
Q7L7Q5
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
199
Molecular Weight:
22kDa
Application:
WB
Immunogen:
The immunogen for anti-RTN4 antibody: synthetic peptide directed towards the middle region of human RTN4
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
RTN4 antibody - middle region (ARP46813_P050)
Predicted Homology Based on Immunogen Sequence:
Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Datasheets / Downloads:
Printable datasheet for
anti-RTN4 antibody
- ARP46813_P050
Peptide Sequence:
Synthetic peptide located within the following region: RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV
Blocking Peptide:
For anti-RTN4 antibody is Catalog # AAP46813 (Previous Catalog # AAPP27612)
Key Reference:
Hu,F. (2008) J. Neurosci. 28 (5), 1262-1269
Reconstitution and Storage:
Add 50 μl of distilled water. Final anti-RTN4 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: RTN4 antibody tested with Human Fetal Muscle Tissue (ARP46813_P050)

Aviva Systems Biology is the original manufacturer of this RTN4 antibody (ARP46813_P050)

Click here to view the RTN4 antibody Western Blot Protocol

Product Datasheet Link: RTN4 antibody (ARP46813_P050)

WB Suggested Anti-RTN4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Muscle

Western Blot image:


Description of Target: RTN4 belongs to the family of reticulons. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. RTN4 is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates.This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s RTN4 antibody (ARP46813_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com