website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

RTN4 antibody - middle region (ARP46813_P050)

Description of Target:
RTN4 belongs to the family of reticulons. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. RTN4 is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates.This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified.
Gene Symbol:
Official Gene Full Name:
Reticulon 4
NCBI Gene Id:
Alias Symbols:
ASY; NI220/250; NOGO; NOGO-A; NOGOC; NSP; NSP-CL; Nbla00271; Nbla10545; Nogo-B; Nogo-C; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C
Tissue Tool:
Find tissues and cell lines supported to express RTN4.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-RTN4 antibody: synthetic peptide directed towards the middle region of human RTN4
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
RTN4 antibody - middle region (ARP46813_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Human, Bovine, Sheep, Dog, Rat, Horse, Rabbit, Guinea pig, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-RTN4 antibody
- ARP46813_P050
Peptide Sequence:
Synthetic peptide located within the following region: RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV
Blocking Peptide:
For anti-RTN4 antibody is Catalog # AAP46813 (Previous Catalog # AAPP27612)
Target Reference:
Hu,F. (2008) J. Neurosci. 28 (5), 1262-1269
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for RTN4 antibody (ARP46813)

Product page for RTN4 antibody (ARP46813)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant RTN4 antibody; Loxodonta africana RTN4 antibody G3T7W4 92%
Bovine Bt.105155 antibody; Bos taurus Bt.105155 antibody F1N405 100%
Bovine RTN4 antibody; Bos taurus RTN4 antibody Q7YRW9 100%
Bovine RTN4 antibody; Bos taurus RTN4 antibody Q1RMR8 100%
Bovine RTN4 antibody; Bos taurus RTN4 antibody A7YVI6 100%
Chimpanzee RTN4 antibody; Pan troglodytes RTN4 antibody Q4FZ93 100%
Common turkey RTN4 antibody; Meleagris gallopavo RTN4 antibody G5E7Z1 78%
Common turkey RTN4 antibody; Meleagris gallopavo RTN4 antibody G3UQY9 78%
Common turkey RTN4 antibody; Meleagris gallopavo RTN4 antibody G1MTX7 78%
Crab-eating macaque RTN4 antibody; Macaca fascicularis RTN4 antibody Q7PCJ7 100%
Dog RTN4 antibody; Canis familiaris RTN4 antibody Q6IG20 100%
Dog RTN4 antibody; Canis familiaris RTN4 antibody E2R925 100%
Duckbill platypus RTN4 antibody; Ornithorhynchus anatinus RTN4 antibody F7FJZ8 92%
Duckbill platypus RTN4 antibody; Ornithorhynchus anatinus RTN4 antibody F7FJU4 92%
Goldfish RTN4 antibody; Carassius auratus RTN4 antibody Q7T222 76%
Gray short-tailed opossum RTN4 antibody; Monodelphis domestica RTN4 antibody F7ABC6 92%
Gray short-tailed opossum RTN4 antibody; Monodelphis domestica RTN4 antibody F6T5Z0 92%
Green anole RTN4 antibody; Anolis carolinensis RTN4 antibody G1KLG9 78%
Guinea pig RTN4 antibody; Cavia porcellus RTN4 antibody H0V091 100%
Horse RTN4 antibody; Equus caballus RTN4 antibody F6VFB4 100%
Human NOGOC antibody; Homo sapiens NOGOC antibody A6XGP7 100%
Human RTN4 antibody; Homo sapiens RTN4 antibody Q9NQC3 100%
Human RTN4 antibody; Homo sapiens RTN4 antibody Q9NQC3-6 100%
Human RTN4 antibody; Homo sapiens RTN4 antibody Q9NQC3-5 100%
Human RTN4 antibody; Homo sapiens RTN4 antibody Q9NQC3-4 100%
Human RTN4 antibody; Homo sapiens RTN4 antibody Q9NQC3-3 100%
Human RTN4 antibody; Homo sapiens RTN4 antibody Q9NQC3-2 100%
Human RTN4 antibody; Homo sapiens RTN4 antibody Q8IUA4 100%
Human RTN4 antibody; Homo sapiens RTN4 antibody Q7L7Q6 100%
Human RTN4 antibody; Homo sapiens RTN4 antibody Q7L7Q5 100%
Human RTN4 antibody; Homo sapiens RTN4 antibody Q6IPN0 100%
Human RTN4 antibody; Homo sapiens RTN4 antibody Q53SY1 100%
Human RTN4 antibody; Homo sapiens RTN4 antibody Q3LIF4 100%
Human RTN4 antibody; Homo sapiens RTN4 antibody F8WAM4 100%
Human RTN4 antibody; Homo sapiens RTN4 antibody F8W914 100%
Human RTN4 antibody; Homo sapiens RTN4 antibody D6W5C2 100%
Little brown bat RTN4 antibody; Myotis lucifugus RTN4 antibody G1PE37 100%
Lowland gorilla RTN4 antibody; Gorilla gorilla gorilla RTN4 antibody G3RRS4 100%
Mouse RTN4 antibody; Mus musculus RTN4 antibody Q99P72 100%
Mouse RTN4 antibody; Mus musculus RTN4 antibody Q99P72-1 100%
Mouse RTN4 antibody; Mus musculus RTN4 antibody Q99P72-3 100%
Mouse Rtn4 antibody; Mus musculus Rtn4 antibody Q8K3G7 100%
Mouse Rtn4 antibody; Mus musculus Rtn4 antibody Q8BHF5 100%
Mouse Rtn4 antibody; Mus musculus Rtn4 antibody Q8BH78 100%
Mouse Rtn4 antibody; Mus musculus Rtn4 antibody Q78NS1 100%
Northern white-cheeked gibbon LOC100590050 antibody; Nomascus leucogenys LOC100590050 antibody G1RDB9 100%
Northern white-cheeked gibbon RTN4 antibody; Nomascus leucogenys RTN4 antibody G1RDC1 100%
Northern white-cheeked gibbon RTN4 antibody; Nomascus leucogenys RTN4 antibody G1RDC0 100%
Northern white-cheeked gibbon RTN4 antibody; Nomascus leucogenys RTN4 antibody G1RDA5 100%
Northern white-cheeked gibbon RTN4 antibody; Nomascus leucogenys RTN4 antibody G1RDA3 100%
Pan troglodytes verus rtn4 antibody A5A6K0 100%
Pig RTN4 antibody; Sus scrofa RTN4 antibody Q6IM70 100%
Pig RTN4 antibody; Sus scrofa RTN4 antibody Q6IG15 100%
Pig RTN4 antibody; Sus scrofa RTN4 antibody F1SQK3 100%
Pig RTN4 antibody; Sus scrofa RTN4 antibody F1SQK2 100%
Pig RTN4 antibody; Sus scrofa RTN4 antibody F1SQK1 100%
Rabbit RTN4 antibody; Oryctolagus cuniculus RTN4 antibody G1T2I5 100%
Rat RTN4 antibody; Rattus norvegicus RTN4 antibody Q9JK11 100%
Rat RTN4 antibody; Rattus norvegicus RTN4 antibody Q9JK11-4 100%
Rat RTN4 antibody; Rattus norvegicus RTN4 antibody Q9JK11-3 100%
Rat RTN4 antibody; Rattus norvegicus RTN4 antibody Q9JK11-2 100%
Rat Rtn4 antibody; Rattus norvegicus Rtn4 antibody Q6IRL3 100%
Rat Rtn4 antibody; Rattus norvegicus Rtn4 antibody Q540J3 100%
Rat Rtn4 antibody; Rattus norvegicus Rtn4 antibody F1LQN3 100%
Rat Rtn4 antibody; Rattus norvegicus Rtn4 antibody D4AEM9 100%
Rat Rtn4 antibody; Rattus norvegicus Rtn4 antibody D3ZT22 100%
Rhesus macaque Mmu.17578 antibody; Macaca mulatta Mmu.17578 antibody F6ZYE6 100%
Rhesus macaque Mmu.17578 antibody; Macaca mulatta Mmu.17578 antibody F6ZYE0 100%
Rhesus macaque Mmu.17578 antibody; Macaca mulatta Mmu.17578 antibody F6ZYD1 100%
Rhesus macaque Mmu.17578 antibody; Macaca mulatta Mmu.17578 antibody F6UZT8 100%
Rhesus macaque Mmu.17578 antibody; Macaca mulatta Mmu.17578 antibody F6UZP9 100%
Rhesus macaque Mmu.17578 antibody; Macaca mulatta Mmu.17578 antibody F6UZN0 100%
Rhesus macaque RTN4 antibody; Macaca mulatta RTN4 antibody Q4FZ92 100%
Rhesus macaque RTN4 antibody; Macaca mulatta RTN4 antibody F6UZQ6 100%
Sheep RTN4 antibody; Ovis aries RTN4 antibody Q4FZ88 100%
Sheep RTN4 antibody; Ovis aries RTN4 antibody B9VGZ5 100%
Small-eared galago RTN4 antibody; Otolemur garnettii RTN4 antibody H0WLC2 100%
Sumatran orangutan RTN4 antibody; Pongo abelii RTN4 antibody Q5R4X9 100%
Tasmanian devil RTN4 antibody; Sarcophilus harrisii RTN4 antibody G3VVU9 85%
White-throated sparrow RTN4 antibody; Zonotrichia albicollis RTN4 antibody D8KWD7 78%
White-throated sparrow RTN4 antibody; Zonotrichia albicollis RTN4 antibody D8KW29 78%
White-tufted-ear marmoset RTN4 antibody; Callithrix jacchus RTN4 antibody F7IMA0 100%
White-tufted-ear marmoset RTN4 antibody; Callithrix jacchus RTN4 antibody F7ICF0 100%
White-tufted-ear marmoset RTN4 antibody; Callithrix jacchus RTN4 antibody F7I1D8 100%
White-tufted-ear marmoset RTN4 antibody; Callithrix jacchus RTN4 antibody F7EBX5 100%
White-tufted-ear marmoset RTN4 antibody; Callithrix jacchus RTN4 antibody F6TPR2 100%
Zebra finch RTN4 antibody; Taeniopygia guttata RTN4 antibody H0Z9R5 78%

Product Protocols: RTN4 antibody tested with Human Fetal Muscle Tissue (ARP46813_P050)

Aviva Systems Biology is the original manufacturer of this RTN4 antibody (ARP46813_P050)

Click here to view the RTN4 antibody Western Blot Protocol

Product Datasheet Link: RTN4 antibody (ARP46813_P050)

WB Suggested Anti-RTN4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Muscle

Western Blot image:

Description of Target: RTN4 belongs to the family of reticulons. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. RTN4 is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates.This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s RTN4 antibody (ARP46813_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question