website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

RTN4 antibody - middle region (ARP46813_P050)

Description of Target:
RTN4 belongs to the family of reticulons. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. RTN4 is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates.This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified.
Gene Symbol:
RTN4
Official Gene Full Name:
Reticulon 4
NCBI Gene Id:
57142
Alias Symbols:
ASY; NI220/250; NOGO; NOGO-A; NOGOC; NSP; NSP-CL; Nbla00271; Nbla10545; Nogo-B; Nogo-C; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C
Tissue Tool:
Find tissues and cell lines supported to express RTN4.
Protein Accession #:
NP_008939
Nucleotide Accession#:
NM_007008
Swissprot Id:
Q7L7Q5
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Reticulon-4
Protein Size (# AA):
199
Molecular Weight:
22kDa
Application:
WB
Immunogen:
The immunogen for anti-RTN4 antibody: synthetic peptide directed towards the middle region of human RTN4
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
RTN4 antibody - middle region (ARP46813_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Human, Bovine, Sheep, Dog, Rat, Horse, Rabbit, Guinea pig, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-RTN4 antibody
- ARP46813_P050
Peptide Sequence:
Synthetic peptide located within the following region: RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV
Blocking Peptide:
For anti-RTN4 antibody is Catalog # AAP46813 (Previous Catalog # AAPP27612)
Key Reference:
Hu,F. (2008) J. Neurosci. 28 (5), 1262-1269
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-RTN4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question