RTN4 Antibody - middle region (ARP46813_P050)

Data Sheet
 
Product Number ARP46813_P050
Product Page www.avivasysbio.com/rtn4-antibody-middle-region-arp46813-p050.html
Name RTN4 Antibody - middle region (ARP46813_P050)
Protein Size (# AA) 199 amino acids
Molecular Weight 22kDa
NCBI Gene Id 57142
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Reticulon 4
Alias Symbols ASY, NSP, NOGO, RTN-X, NSP-CL, RTN4-A, RTN4-C, RTN4-B1, RTN4-B2, NI220/250, Nbla00271, Nbla10545
Peptide Sequence Synthetic peptide located within the following region: RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hu,F. (2008) J. Neurosci. 28 (5), 1262-1269
Description of Target RTN4 belongs to the family of reticulons. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. RTN4 is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates.This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified.
Protein Interactions HUWE1; SYT16; ZFYVE21; RTN4; SNX15; ARL6IP1; SNX1; UBC; RPA3; RPA2; RPA1; vpu; BAIAP2; LAMA4; ATF2; CLN8; TMEM65; S100A16; EPPK1; SNX12; ACAA2; SLC9A3R2; TJP1; HNRNPM; ILF3; IGFBP7; DDB1; SLC25A10; CIRBP; TERF1; POT1; RPS27; NR4A1; HLA-DPB1; RTN3; RTN4IP1
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RTN4 (ARP46813_P050) antibody
Blocking Peptide For anti-RTN4 (ARP46813_P050) antibody is Catalog # AAP46813 (Previous Catalog # AAPP27612)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RTN4
Uniprot ID Q7L7Q5
Protein Name Reticulon-4
Protein Accession # NP_008939
Purification Affinity Purified
Nucleotide Accession # NM_007008
Tested Species Reactivity Human
Gene Symbol RTN4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Image 1
Human Muscle
WB Suggested Anti-RTN4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com