SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP43232_P050
Price: $0.00
SKU
ARP43232_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MARCH5 (ARP43232_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MARCH5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: CRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVY
Concentration0.5 mg/ml
Blocking PeptideFor anti-MARCH5 (ARP43232_P050) antibody is Catalog # AAP43232 (Previous Catalog # AAPP11307)
ReferenceKarbowski,M., (2007) J. Cell Biol. 178 (1), 71-84
Publications

Cilenti, L. et al. Inactivation of Omi/HtrA2 protease leads to the deregulation of mitochondrial Mulan E3 ubiquitin ligase and increased mitophagy. Biochim. Biophys. Acta 1843, 1295-307 (2014). 24709290

Gene SymbolMARCH5
Gene Full NameMembrane-associated ring finger (C3HC4) 5
Alias SymbolsMITOL, MARCH5, RNF153, MARCH-V
NCBI Gene Id54708
Protein NameE3 ubiquitin-protein ligase MARCH5
Description of TargetMARCH5 is an ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2) and DRP1 (DNM1L). MARCH5 is a ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2; MIM 608507) and DRP1 (DNM1L; MIM 603850) (Nakamura et al., 2006 [PubMed 16936636]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1502 AK000452.1 3-1504 1503-1863 BC015480.1 1463-1823 1864-1901 BE393612.1 438-475 1902-3713 BC015480.1 1852-3663 3714-3941 BC015480.1 3669-3896
Uniprot IDQ9NX47
Protein Accession #NP_060294
Nucleotide Accession #NM_017824
Protein Size (# AA)278
Molecular Weight31kDa
Protein InteractionsFATE1; UBE2W; UBC; DNM1L; MFN2; UBE2E1; FIS1; UBE2E3; MFN1; PARK2; MARCH5; CCNB1; UBE2D3; UBE2D2; UBE2D1; MAP1B; KIAA0368; SOD1; MAVS; TANK; TRAF6; AKTIP; UBE2T; UBE2N; UBE2I; UTRN;
  1. What is the species homology for "MARCH5 Antibody - N-terminal region (ARP43232_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "MARCH5 Antibody - N-terminal region (ARP43232_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MARCH5 Antibody - N-terminal region (ARP43232_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MARCH5 Antibody - N-terminal region (ARP43232_P050)"?

    This target may also be called "MITOL, MARCH5, RNF153, MARCH-V" in publications.

  5. What is the shipping cost for "MARCH5 Antibody - N-terminal region (ARP43232_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MARCH5 Antibody - N-terminal region (ARP43232_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MARCH5 Antibody - N-terminal region (ARP43232_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "31kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MARCH5 Antibody - N-terminal region (ARP43232_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MARCH5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MARCH5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MARCH5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MARCH5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MARCH5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MARCH5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MARCH5 Antibody - N-terminal region (ARP43232_P050)
Your Rating
We found other products you might like!