Size:100 ul
$319.00
In Stock
SKU
ARP43232_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43232_P050-FITC Conjugated

ARP43232_P050-HRP Conjugated

ARP43232_P050-Biotin Conjugated

MARCH5 Antibody - N-terminal region (ARP43232_P050)

Catalog#: ARP43232_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-109542 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MARCH5
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-MARCH5 (ARP43232_P050)
Peptide Sequence Synthetic peptide located within the following region: CRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVY
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MARCH5 (ARP43232_P050) antibody is Catalog # AAP43232 (Previous Catalog # AAPP11307)
Datasheets/Manuals Printable datasheet for anti-MARCH5 (ARP43232_P050) antibody
Target Reference Karbowski,M., (2007) J. Cell Biol. 178 (1), 71-84
Publications

Cilenti, L. et al. Inactivation of Omi/HtrA2 protease leads to the deregulation of mitochondrial Mulan E3 ubiquitin ligase and increased mitophagy. Biochim. Biophys. Acta 1843, 1295-307 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24709290

Gene Symbol MARCH5
Official Gene Full Name Membrane-associated ring finger (C3HC4) 5
Alias Symbols FLJ20445, MARCH-V, MITOL, RNF153
NCBI Gene Id 54708
Protein Name E3 ubiquitin-protein ligase MARCH5
Description of Target MARCH5 is an ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2) and DRP1 (DNM1L). MARCH5 is a ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2; MIM 608507) and DRP1 (DNM1L; MIM 603850) (Nakamura et al., 2006 [PubMed 16936636]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1502 AK000452.1 3-1504 1503-1863 BC015480.1 1463-1823 1864-1901 BE393612.1 438-475 1902-3713 BC015480.1 1852-3663 3714-3941 BC015480.1 3669-3896
Swissprot Id Q9NX47
Protein Accession # NP_060294
Nucleotide Accession # NM_017824
Protein Size (# AA) 278
Molecular Weight 31kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MARCH5.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MARCH5.
Protein Interactions FATE1; UBE2W; UBC; DNM1L; MFN2; UBE2E1; FIS1; UBE2E3; MFN1; PARK2; MARCH5; CCNB1; UBE2D3; UBE2D2; UBE2D1; MAP1B; KIAA0368; SOD1; MAVS; TANK; TRAF6; AKTIP; UBE2T; UBE2N; UBE2I; UTRN;
  1. What is the species homology for "MARCH5 Antibody - N-terminal region (ARP43232_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "MARCH5 Antibody - N-terminal region (ARP43232_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MARCH5 Antibody - N-terminal region (ARP43232_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MARCH5 Antibody - N-terminal region (ARP43232_P050)"?

    This target may also be called "FLJ20445, MARCH-V, MITOL, RNF153" in publications.

  5. What is the shipping cost for "MARCH5 Antibody - N-terminal region (ARP43232_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MARCH5 Antibody - N-terminal region (ARP43232_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MARCH5 Antibody - N-terminal region (ARP43232_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "31kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MARCH5 Antibody - N-terminal region (ARP43232_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MARCH5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MARCH5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MARCH5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MARCH5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MARCH5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MARCH5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MARCH5 Antibody - N-terminal region (ARP43232_P050)
Your Rating
We found other products you might like!