H3f3a Antibody - N-terminal region (ARP60983_P050)

Catalog No: ARP60983_P050

WB Suggested Anti-H3f3a Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Spleen

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Rat, Dog, Pig, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: KSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: Catalog # AAP60983

Target Info

• Gene Symbol: H3f3a
• Gene Full Name: H3 histone, family 3A
• Alias Symbols: H3-3, H3.3, H3-3a, H3-3b, H3.3A, EyeLinc14
• NCBI Gene Id: 15078
• Protein Name: Histone H3.3
• Description of Target: H3f3a is a variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in active genes. H3f3a constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. H3f3a is deposited at sites of nucleosomal displacement throughout transcribed genes, suggesting that it represents an epigenetic imprint of transcriptionally active chromatin. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
• Uniprot ID: P84244
• Protein Accession #: NP_032236
• Nucleotide Accession #: NM_008210
• Protein Size (# AA): 126
• Molecular Weight: 15kDa
• Protein Interactions: Kmt2d; Chd5; Setd1a; Kmt2c; Setd1b; Ezh2; Chd1; Cbx3; Uhrf1; Nfkb2; Hdac5; Hdac3; Kdm6b; Nfe2; Aurka; Cbx2; Ehmt2; Cbx5; Aurkb; Cbx6; Bptf; Creb3l4; Ing2; Cbx7; Cbx8; Cbx4; Cd4; Fosb; Rps6ka5; Rps6ka3; Igh-8; Cd79a; Tcrb; Eif2s3x; Kdm5c; Nanog; Kcnq1ot1;