HRH4 Antibody - middle region (ARP63567_P050)

Catalog No: ARP63567_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-HRH4 Antibody
Titration: 1.0 ug/ml
Positive Control: 721_B Whole CellHRH4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Pig: 79%
• Peptide Sequence: Synthetic peptide located within the following region: GRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HRH4 (ARP63567_P050) antibody is Catalog # AAP63567
• Sample Type Confirmation:

  HRH4 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Info

• Gene Symbol: HRH4
• Gene Full Name: Histamine receptor H4
• Alias Symbols: H4, H4R, BG26, HH4R, AXOR35, GPRv53, GPCR105
• NCBI Gene Id: 59340
• Protein Name: Histamine H4 receptor
• Description of Target: Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by a family of histamine receptors, which are a subset of the G-protein coupled receptor superfamily. This gene encodes a histamine receptor that is predominantly expressed in haematopoietic cells. The protein is thought to play a role in inflammation and allergy reponses. Multiple transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: B2KJ48
• Protein Accession #: NP_001137300
• Nucleotide Accession #: NM_001143828
• Protein Size (# AA): 302
• Molecular Weight: 33kDa
• Protein Interactions: CCL16; GNA15; GNAO1; GNAI1;