SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP63567_P050
Price: $0.00
SKU
ARP63567_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HRH4 (ARP63567_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Pig: 79%
Peptide SequenceSynthetic peptide located within the following region: GRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSF
Concentration0.5 mg/ml
Blocking PeptideFor anti-HRH4 (ARP63567_P050) antibody is Catalog # AAP63567
Sample Type Confirmation

HRH4 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Gene SymbolHRH4
Gene Full NameHistamine receptor H4
Alias SymbolsH4, H4R, BG26, HH4R, AXOR35, GPRv53, GPCR105
NCBI Gene Id59340
Protein NameHistamine H4 receptor
Description of TargetHistamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by a family of histamine receptors, which are a subset of the G-protein coupled receptor superfamily. This gene encodes a histamine receptor that is predominantly expressed in haematopoietic cells. The protein is thought to play a role in inflammation and allergy reponses. Multiple transcript variants encoding different isoforms have been found for this gene.
Uniprot IDB2KJ48
Protein Accession #NP_001137300
Nucleotide Accession #NM_001143828
Protein Size (# AA)302
Molecular Weight33kDa
Protein InteractionsCCL16; GNA15; GNAO1; GNAI1;
  1. What is the species homology for "HRH4 Antibody - middle region (ARP63567_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Pig".

  2. How long will it take to receive "HRH4 Antibody - middle region (ARP63567_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HRH4 Antibody - middle region (ARP63567_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HRH4 Antibody - middle region (ARP63567_P050)"?

    This target may also be called "H4, H4R, BG26, HH4R, AXOR35, GPRv53, GPCR105" in publications.

  5. What is the shipping cost for "HRH4 Antibody - middle region (ARP63567_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HRH4 Antibody - middle region (ARP63567_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HRH4 Antibody - middle region (ARP63567_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HRH4 Antibody - middle region (ARP63567_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HRH4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HRH4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HRH4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HRH4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HRH4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HRH4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HRH4 Antibody - middle region (ARP63567_P050)
Your Rating