website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

ANKRD11 antibody - N-terminal region (ARP33542_T100)

Description of Target:
ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.
Gene Symbol:
Official Gene Full Name:
Ankyrin repeat domain 11
NCBI Gene Id:
Alias Symbols:
T13; LZ16; ANCO1; ANCO-1
Tissue Tool:
Find tissues and cell lines supported to express ANKRD11.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Nasopharyngeal carcinoma susceptibility protein LZ16 EMBL AAF24125.1
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-ANKRD11 antibody: synthetic peptide directed towards the N terminal of human ANKRD11
Product Format:
Lyophilized powder
Protein A purified
Complete computational species homology data:
ANKRD11 antibody - N-terminal region (ARP33542_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Zebrafish: 86%
Species Reactivity:
Human, Mouse, Rat, Bovine, Horse, Rabbit, Dog, Guinea pig, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-ANKRD11 antibody
- ARP33542_T100
Peptide Sequence:
Synthetic peptide located within the following region: KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR
Blocking Peptide:
For anti-ANKRD11 antibody is Catalog # AAP33542 (Previous Catalog # AAPP04593)
Key Reference:
Zhang,A., et al., (2004) J. Biol. Chem. 279 (32), 33799-33805
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-ANKRD11 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question