website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

ANKRD11 antibody - N-terminal region (ARP33542_T100)

Description of Target:
ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.
Gene Symbol:
ANKRD11
Official Gene Full Name:
Ankyrin repeat domain 11
NCBI Gene Id:
29123
Alias Symbols:
T13; LZ16; ANCO1; ANCO-1
Tissue Tool:
Find tissues and cell lines supported to express ANKRD11.
Protein Accession #:
NP_037407
Nucleotide Accession#:
NM_013275
Swissprot Id:
Q9UHR3
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Nasopharyngeal carcinoma susceptibility protein LZ16 EMBL AAF24125.1
Protein Size (# AA):
2663
Molecular Weight:
298kDa
Application:
IHC, WB
Partner Proteins:
CRISP3, CRISP3
Immunogen:
The immunogen for anti-ANKRD11 antibody: synthetic peptide directed towards the N terminal of human ANKRD11
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
ANKRD11 antibody - N-terminal region (ARP33542_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Zebrafish: 86%
Species Reactivity:
Human, Mouse, Rat, Bovine, Horse, Rabbit, Dog, Guinea pig, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-ANKRD11 antibody
- ARP33542_T100
Peptide Sequence:
Synthetic peptide located within the following region: KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR
Blocking Peptide:
For anti-ANKRD11 antibody is Catalog # AAP33542 (Previous Catalog # AAPP04593)
Target Reference:
Zhang,A., et al., (2004) J. Biol. Chem. 279 (32), 33799-33805
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-ANKRD11 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for ANKRD11 antibody (ARP33542)

Product page for ANKRD11 antibody (ARP33542)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog ankrd11 antibody; Xenopus laevis ankrd11 antibody Q6GQ19 85%
African elephant ANKRD11 antibody; Loxodonta africana ANKRD11 antibody G3TUX2 100%
African elephant ANKRD11 antibody; Loxodonta africana ANKRD11 antibody G3UAA2 100%
Bovine ANKRD11 antibody; Bos taurus ANKRD11 antibody E1BAT5 100%
Chicken ANKRD11 antibody; Gallus gallus ANKRD11 antibody E1BYW8 85%
Common turkey ANKRD11 antibody; Meleagris gallopavo ANKRD11 antibody G1N7A2 85%
Dog ANKRD11 antibody; Canis familiaris ANKRD11 antibody E2R4E8 100%
Giant panda ANKRD11 antibody; Ailuropoda melanoleuca ANKRD11 antibody G1L2M0 100%
Guinea pig ANKRD11 antibody; Cavia porcellus ANKRD11 antibody H0V7X4 93%
Human ANKRD11 antibody; Homo sapiens ANKRD11 antibody Q9UHR3 100%
Human ANKRD11 antibody; Homo sapiens ANKRD11 antibody Q59GC3 100%
Human ANKRD11 antibody; Homo sapiens ANKRD11 antibody H0Y3E3 100%
Human ANR11 antibody; Homo sapiens ANR11 antibody Q6UB99 100%
Little brown bat ANKRD11 antibody; Myotis lucifugus ANKRD11 antibody G1PUP0 100%
Lowland gorilla ANKRD11 antibody; Gorilla gorilla gorilla ANKRD11 antibody G3RSW7 100%
Lowland gorilla ANKRD11 antibody; Gorilla gorilla gorilla ANKRD11 antibody G3RP51 100%
Lowland gorilla ANKRD11 antibody; Gorilla gorilla gorilla ANKRD11 antibody G3RHJ2 100%
Mouse Ankrd11 antibody; Mus musculus Ankrd11 antibody Q05DP4 100%
Mouse Ankrd11 antibody; Mus musculus Ankrd11 antibody E9Q4F7 100%
Mouse Ankrd11 antibody; Mus musculus Ankrd11 antibody B2RY01 100%
Mouse Ankrd11 antibody; Mus musculus Ankrd11 antibody Q6NV79 100%
Mouse Ankrd11 antibody; Mus musculus Ankrd11 antibody G3UY79 91%
Mouse Ankrd11 antibody; Mus musculus Ankrd11 antibody E9PXS7 91%
Northern white-cheeked gibbon ANKRD11 antibody; Nomascus leucogenys ANKRD11 antibody G1S0M9 100%
Rabbit ANKRD11 antibody; Oryctolagus cuniculus ANKRD11 antibody G1SJ80 100%
Rat Ankrd11 antibody; Rattus norvegicus Ankrd11 antibody D3ZSU6 100%
Rhesus macaque ANKRD11 antibody; Macaca mulatta ANKRD11 antibody F6QAD2 100%
Rhesus macaque ANKRD11 antibody; Macaca mulatta ANKRD11 antibody F6QAC1 100%
Rhesus macaque ANKRD11 antibody; Macaca mulatta ANKRD11 antibody F6QAA9 100%
Rhesus macaque ANKRD11 antibody; Macaca mulatta ANKRD11 antibody F6QAE8 100%
Rhesus macaque ANKRD11 antibody; Macaca mulatta ANKRD11 antibody F7H0T3 93%
Small-eared galago ANKRD11 antibody; Otolemur garnettii ANKRD11 antibody H0XN25 100%
White-tufted-ear marmoset LOC100391198 antibody; Callithrix jacchus LOC100391198 antibody F7HHW1 100%
White-tufted-ear marmoset LOC100391198 antibody; Callithrix jacchus LOC100391198 antibody F7HHQ5 100%
White-tufted-ear marmoset LOC100391198 antibody; Callithrix jacchus LOC100391198 antibody F7HHX0 93%

Product Protocols: ANKRD11 antibody tested with Human Placenta Tissue (ARP33542_T100)

Aviva Systems Biology is the original manufacturer of this ANKRD11 antibody (ARP33542_T100)

Click here to view the ANKRD11 antibody Western Blot Protocol

Product Datasheet Link: ANKRD11 antibody (ARP33542_T100)

WB Suggested Anti-ANKRD11 Antibody Titration: 1.25ug/ml
Positive Control: Placenta

Western Blot image:


Description of Target: ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s ANKRD11 antibody (ARP33542_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: ANKRD11 antibody tested by IHC with human kidney (ARP33542)

Aviva Systems Biology is the original manufacturer of this ANKRD11 antibody.

Click here to view the ANKRD11 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: ANKRD11 antibody (ARP33542)

IHC Information:

Rabbit Anti-ANKRD11 Antibody
Catalog Number: ARP33542
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

 
X
Ask a Question