website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

ANKRD11 antibody - N-terminal region (ARP33542_T100)

Description of Target:
ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.
Gene Symbol:
Official Gene Full Name:
Ankyrin repeat domain 11
NCBI Gene Id:
Alias Symbols:
T13; LZ16; ANCO1; ANCO-1
Tissue Tool:
Find tissues and cell lines supported to express ANKRD11.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Nasopharyngeal carcinoma susceptibility protein LZ16 EMBL AAF24125.1
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-ANKRD11 antibody: synthetic peptide directed towards the N terminal of human ANKRD11
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein A purified
Complete computational species homology data:
ANKRD11 antibody - N-terminal region (ARP33542_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Zebrafish: 86%
Species Reactivity:
Human, Mouse, Rat, Bovine, Horse, Rabbit, Dog, Guinea pig, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-ANKRD11 antibody
- ARP33542_T100
Peptide Sequence:
Synthetic peptide located within the following region: KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR
Blocking Peptide:
For anti-ANKRD11 antibody is Catalog # AAP33542 (Previous Catalog # AAPP04593)
Target Reference:
Zhang,A., et al., (2004) J. Biol. Chem. 279 (32), 33799-33805
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: ANKRD11 antibody tested with Human Placenta Tissue (ARP33542_T100)

Aviva Systems Biology is the original manufacturer of this ANKRD11 antibody (ARP33542_T100)

Click here to view the ANKRD11 antibody Western Blot Protocol

Product Datasheet Link: ANKRD11 antibody (ARP33542_T100)

WB Suggested Anti-ANKRD11 Antibody Titration: 1.25ug/ml
Positive Control: Placenta

Western Blot image:

Description of Target: ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s ANKRD11 antibody (ARP33542_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: ANKRD11 antibody tested by IHC with human kidney (ARP33542)

Aviva Systems Biology is the original manufacturer of this ANKRD11 antibody.

Click here to view the ANKRD11 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: ANKRD11 antibody (ARP33542)

IHC Information:

Rabbit Anti-ANKRD11 Antibody
Catalog Number: ARP33542
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question