Catalog No: ARP33542_T100
Price: $0.00
SKU
ARP33542_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ANKRD11 (ARP33542_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ANKRD11
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR
Concentration1.0 mg/ml
Blocking PeptideFor anti-ANKRD11 (ARP33542_T100) antibody is Catalog # AAP33542 (Previous Catalog # AAPP04593)
ReferenceZhang,A., et al., (2004) J. Biol. Chem. 279 (32), 33799-33805
Gene SymbolANKRD11
Gene Full NameAnkyrin repeat domain 11
Alias SymbolsT13, LZ16, ANCO1, ANCO-1
NCBI Gene Id29123
Protein NameNasopharyngeal carcinoma susceptibility protein LZ16 EMBL AAF24125.1;
Ankyrin repeat domain 11 isoform A
Description of TargetANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.
Uniprot IDQ9UHR3, X5D778
Protein Accession #NP_037407
Nucleotide Accession #NM_013275
Protein Size (# AA)2663
Molecular Weight298kDa
Protein InteractionsLZTS2; CEP44; CDCA7L; HOOK2; TFIP11; IKZF1; PDE4DIP; BZRAP1; MKRN3; TRAF2; TRIM37; GOLGA2; HDAC3; UBC; HDAC5; NCOA2; HDAC4; RAC3; SRC; ANKRD11; NCOA3; NCOA1;
  1. What is the species homology for "ANKRD11 Antibody - N-terminal region (ARP33542_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "ANKRD11 Antibody - N-terminal region (ARP33542_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ANKRD11 Antibody - N-terminal region (ARP33542_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ANKRD11 Antibody - N-terminal region (ARP33542_T100)"?

    This target may also be called "T13, LZ16, ANCO1, ANCO-1" in publications.

  5. What is the shipping cost for "ANKRD11 Antibody - N-terminal region (ARP33542_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ANKRD11 Antibody - N-terminal region (ARP33542_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ANKRD11 Antibody - N-terminal region (ARP33542_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "298kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ANKRD11 Antibody - N-terminal region (ARP33542_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ANKRD11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ANKRD11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ANKRD11"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ANKRD11"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ANKRD11"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ANKRD11"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ANKRD11 Antibody - N-terminal region (ARP33542_T100)
Your Rating