SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP40568_T100 (Formerly GWB-38315A )
Price: $0.00
SKU
ARP40568_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PCBP2 (ARP40568_T100) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PCBP2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ
Concentration1.0 mg/ml
Blocking PeptideFor anti-PCBP2 (ARP40568_T100) antibody is Catalog # AAP40568 (Previous Catalog # AAPP22746)
Sample Type Confirmation

There is BioGPS gene expression data showing that PCBP2 is expressed in Jurkat

ReferenceOh,J.H., (2005) Mamm. Genome 16 (12), 942-954
Publications

Han, W. et al. RNA-binding protein PCBP2 modulates glioma growth by regulating FHL3. J. Clin. Invest. 123, 2103-18 (2013). 23585479

Interplay between PCBP2 and miRNA modulates ARHGDIA expression and function in glioma migration and invasion. Oncotarget. 7, 19483-98 (2016). 26761212

Gene SymbolPCBP2
Gene Full NamePoly(rC) binding protein 2
Alias SymbolsHNRPE2, HNRNPE2, hnRNP-E2
NCBI Gene Id5094
Protein NamePoly(rC)-binding protein 2
Description of TargetPCBP2 appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. This protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This gene and PCBP-1 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes.The protein encoded by this gene appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1 intronless gene which has similar functions. This gene and PCBP-1 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes. It also has two processed pseudogenes PCBP2P1 and PCBP2P2. There are presently two alternatively spliced transcript variants described for this gene.
Uniprot IDQ6IPF4
Protein Accession #NP_005007
Nucleotide Accession #NM_005016
Protein Size (# AA)366
Molecular Weight40kDa
Protein InteractionsFUS; HUWE1; UBC; SNRPA; SUMO2; SUMO3; CEP250; MDM2; EED; TARDBP; ADRB2; IGSF8; HMGA1; CD81; HMGA2; WDR83; SLU7; CASK; UBL4A; VCAM1; PCBP2; NOS2; ITGA4; FN1; BRCA1; PRPF40A; SF3B2; NKAP; WDR77; PAXIP1; BARD1; PPIB; EEF1A1; FBXO6; UBD; PCBP1; QKI; CDK2; COP
  1. What is the species homology for "PCBP2 Antibody - middle region (ARP40568_T100)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse".

  2. How long will it take to receive "PCBP2 Antibody - middle region (ARP40568_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PCBP2 Antibody - middle region (ARP40568_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PCBP2 Antibody - middle region (ARP40568_T100)"?

    This target may also be called "HNRPE2, HNRNPE2, hnRNP-E2" in publications.

  5. What is the shipping cost for "PCBP2 Antibody - middle region (ARP40568_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PCBP2 Antibody - middle region (ARP40568_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PCBP2 Antibody - middle region (ARP40568_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PCBP2 Antibody - middle region (ARP40568_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PCBP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PCBP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PCBP2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PCBP2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PCBP2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PCBP2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PCBP2 Antibody - middle region (ARP40568_T100)
Your Rating
We found other products you might like!