PAX5 Antibody - N-terminal region (ARP34686_P050)

Catalog No: ARP34686_P050

WB Suggested Anti-PAX5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Host: Rabbit
Target Name: PAX8
Sample Type: Human 721_B
Antibody Dilution: 1.0ug/mlPAX5 is supported by BioGPS gene expression data to be expressed in 721_B

Human kidney

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PAX5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: CVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PAX5 (ARP34686_P050) antibody is Catalog # AAP34686 (Previous Catalog # AAPP05876)
• Sample Type Confirmation:

  PAX5 is supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Robichaud,G.A., et al., (2004) J. Biol. Chem. 279 (48), 49956-49963

Target Info

• Gene Symbol: PAX5
• Gene Full Name: Paired box 5
• Alias Symbols: ALL3, BSAP
• NCBI Gene Id: 5079
• Protein Name: Paired box protein Pax-5
• Description of Target: The PAX5 gene is a member of the paired box (PAX) family of transcription factors. The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box. The PAX proteins are important regulators in early development, and alterations in the expression of their genes are thought to contribute to neoplastic transformation. The PAX5 gene encodes the B-cell lineage specific activator protein (BSAP) that is expressed at early, but not late stages of B-cell differentiation. Its expression has also been detected in developing CNS and testis, therefore, PAX5 gene product may not only play an important role in B-cell differentiation, but also in neural development and spermatogenesis.
• Uniprot ID: Q02548
• Protein Accession #: NP_057953
• Nucleotide Accession #: NM_016734
• Protein Size (# AA): 391
• Molecular Weight: 42kDa
• Protein Interactions: TBP; RB1; EP300; RUNX1; TLE4; DAXX; KPNA1; KPNA2; ID2; ID3; CREBBP; MYB; PAX5; ETS1; EBF1;