PAX5 Antibody - N-terminal region (ARP34686_P050)

• Product Number: ARP34686_P050
• Name: PAX5 Antibody - N-terminal region (ARP34686_P050)
• Protein Size (# AA): 391 amino acids
• Molecular Weight: 42kDa
• NCBI Gene Id: 5079
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Paired box 5
• Alias Symbols: ALL3, BSAP
• Peptide Sequence: Synthetic peptide located within the following region: CVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Robichaud,G.A., et al., (2004) J. Biol. Chem. 279 (48), 49956-49963
• Description of Target: The PAX5 gene is a member of the paired box (PAX) family of transcription factors. The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box. The PAX proteins are important regulators in early development, and alterations in the expression of their genes are thought to contribute to neoplastic transformation. The PAX5 gene encodes the B-cell lineage specific activator protein (BSAP) that is expressed at early, but not late stages of B-cell differentiation. Its expression has also been detected in developing CNS and testis, therefore, PAX5 gene product may not only play an important role in B-cell differentiation, but also in neural development and spermatogenesis.
• Protein Interactions: TBP; RB1; EP300; RUNX1; TLE4; DAXX; KPNA1; KPNA2; ID2; ID3; CREBBP; MYB; PAX5; ETS1; EBF1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PAX5 (ARP34686_P050) antibody is Catalog # AAP34686 (Previous Catalog # AAPP05876)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PAX5
• Uniprot ID: Q02548
• Protein Name: Paired box protein Pax-5
• Sample Type Confirmation:

  PAX5 is supported by BioGPS gene expression data to be expressed in 721_B

• Protein Accession #: NP_057953
• Purification: Affinity Purified
• Nucleotide Accession #: NM_016734
• Tested Species Reactivity: Human
• Gene Symbol: PAX5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-PAX5 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysate
• Image 2: Human kidney
  
  Human kidney
• Image 3: Human 721_B
  
  Host: Rabbit
  Target Name: PAX8
  Sample Type: Human 721_B
  Antibody Dilution: 1.0ug/mlPAX5 is supported by BioGPS gene expression data to be expressed in 721_B