SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP35347_P050
Price: $0.00
SKU
ARP35347_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-KCNK13 (ARP35347_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human KCNK13
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHorse: 79%; Human: 100%; Pig: 79%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA
Concentration0.5 mg/ml
Blocking PeptideFor anti-KCNK13 (ARP35347_P050) antibody is Catalog # AAP35347 (Previous Catalog # AAPP06582)
Sample Type Confirmation

KCNK13 is supported by BioGPS gene expression data to be expressed in 721_B

ReferenceRajan,S., et al., (2001) J. Biol. Chem. 276 (10), 7302-7311
Publications

Dysregulation of a potassium channel, THIK-1, targeted by caspase-8 accelerates cell shrinkage. Biochim. Biophys. Acta. 1863, 2766-2783 (2016). 27566292

Gene SymbolKCNK13
Gene Full NamePotassium channel, subfamily K, member 13
Alias SymbolsTHIK1, THIK-1, K2p13.1
NCBI Gene Id56659
Protein NamePotassium channel subfamily K member 13
Description of TargetKCNK13 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming domains. The product of this gene is an open channel that can be stimulated by arachidonic acid.
Uniprot IDQ9HB14
Protein Accession #NP_071337
Nucleotide Accession #NM_022054
Protein Size (# AA)408
Molecular Weight45kDa
  1. What is the species homology for "KCNK13 Antibody - C-terminal region (ARP35347_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Horse, Pig".

  2. How long will it take to receive "KCNK13 Antibody - C-terminal region (ARP35347_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KCNK13 Antibody - C-terminal region (ARP35347_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KCNK13 Antibody - C-terminal region (ARP35347_P050)"?

    This target may also be called "THIK1, THIK-1, K2p13.1" in publications.

  5. What is the shipping cost for "KCNK13 Antibody - C-terminal region (ARP35347_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KCNK13 Antibody - C-terminal region (ARP35347_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KCNK13 Antibody - C-terminal region (ARP35347_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KCNK13 Antibody - C-terminal region (ARP35347_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "KCNK13"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KCNK13"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KCNK13"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KCNK13"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KCNK13"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KCNK13"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KCNK13 Antibody - C-terminal region (ARP35347_P050)
Your Rating
We found other products you might like!