| Product Number |
ARP35347_P050 |
| Product Page |
www.avivasysbio.com/kcnk13-antibody-c-terminal-region-arp35347-p050.html |
| Name |
KCNK13 Antibody - C-terminal region (ARP35347_P050) |
| Protein Size (# AA) |
408 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
56659 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Potassium channel, subfamily K, member 13 |
| Alias Symbols |
THIK1, THIK-1, K2p13.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Rajan,S., et al., (2001) J. Biol. Chem. 276 (10), 7302-7311 |
| Description of Target |
KCNK13 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming domains. The product of this gene is an open channel that can be stimulated by arachidonic acid. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KCNK13 (ARP35347_P050) antibody |
| Blocking Peptide |
For anti-KCNK13 (ARP35347_P050) antibody is Catalog # AAP35347 (Previous Catalog # AAPP06582) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human KCNK13 |
| Uniprot ID |
Q9HB14 |
| Protein Name |
Potassium channel subfamily K member 13 |
| Publications |
Dysregulation of a potassium channel, THIK-1, targeted by caspase-8 accelerates cell shrinkage. Biochim. Biophys. Acta. 1863, 2766-2783 (2016). 27566292 |
| Sample Type Confirmation |
KCNK13 is supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
NP_071337 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_022054 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KCNK13 |
| Predicted Species Reactivity |
Human, Rat, Horse, Pig |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 79%; Human: 100%; Pig: 79%; Rat: 79% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-KCNK13 Antibody Titration: 0.12ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
| Image 2 | MDCK Cells
 | Researcher: Delphine Bichet, University of Nice-Sophia-Antipolis
Application: IHC
Species + Tissue/Cell type: MDCK Cells
Primary antibody dilution: 1:100
Secondary antibody: Anti-rabbit-Alexa488
Secondary antibody dilution: 1:1000 |
|
| Image 3 | Human Brain
 | Rabbit Anti-Q9HB14 Antibody
Catalog Number: ARP35347
Paraffin Embedded Tissue: Human Brain
Cellular Data: Neural Cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X - See more at: http://www.avivasysbio.com/anti-kcnk13-antibody-c-terminal-region-arp35347-p050.html#sthash.wo6qTH90.dpuf |
|
| Image 4 | Human 721_B
 | Host: Rabbit
Target Name: KCNK13
Sample Type: 721_B
Antibody Dilution: 1.0ug/mlKCNK13 is supported by BioGPS gene expression data to be expressed in 721_B |
|
