FADS1 Antibody - C-terminal region (ARP42384_T100)

Catalog No: ARP42384_T100

Host: Rabbit
Target Name: FADS1
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0ug/ml

Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FADS1
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-FADS1 (ARP42384_T100) antibody is Catalog # AAP42384 (Previous Catalog # AAPP24736)
• Sample Type Confirmation:

  FADS1 is strongly supported by BioGPS gene expression data to be expressed in K562

• Reference: Otsuki,T., (2005) DNA Res. 12 (2), 117-126

Target Info

• Gene Symbol: FADS1
• Gene Full Name: Fatty acid desaturase 1
• Alias Symbols: D5D, TU12, FADS6, FADSD5, LLCDL1
• NCBI Gene Id: 3992
• Protein Name: Fatty acid desaturase 1
• Description of Target: FADS1 is a member of the fatty acid desaturase (FADS) family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs.The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization.
• Uniprot ID: O60427
• Protein Accession #: NP_037534
• Nucleotide Accession #: NM_013402
• Protein Size (# AA): 444
• Molecular Weight: 49kDa
• Protein Interactions: UBC; XRN1; PAAF1; DHCR7;