FADS1 Antibody - C-terminal region (ARP42384_T100)

• Product Number: ARP42384_T100
• Name: FADS1 Antibody - C-terminal region (ARP42384_T100)
• Protein Size (# AA): 444 amino acids
• Molecular Weight: 49kDa
• NCBI Gene Id: 3992
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Fatty acid desaturase 1
• Alias Symbols: D5D, TU12, FADS6, FADSD5, LLCDL1
• Peptide Sequence: Synthetic peptide located within the following region: FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Otsuki,T., (2005) DNA Res. 12 (2), 117-126
• Description of Target: FADS1 is a member of the fatty acid desaturase (FADS) family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs.The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization.
• Protein Interactions: UBC; XRN1; PAAF1; DHCR7;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FADS1 (ARP42384_T100) antibody is Catalog # AAP42384 (Previous Catalog # AAPP24736)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FADS1
• Uniprot ID: O60427
• Protein Name: Fatty acid desaturase 1
• Sample Type Confirmation:

  FADS1 is strongly supported by BioGPS gene expression data to be expressed in K562

• Protein Accession #: NP_037534
• Purification: Protein A purified
• Nucleotide Accession #: NM_013402
• Tested Species Reactivity: Human
• Gene Symbol: FADS1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Muscle
  
  Human Muscle
• Image 2: Human Fetal Liver
  
  Host: Rabbit
  Target Name: FADS1
  Sample Tissue: Human Fetal Liver
  Antibody Dilution: 1.0ug/ml