ZNF468 Antibody - middle region (ARP50879_P050)

Catalog No: ARP50879_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-ZNF468 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: PANC1 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Horse, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF468
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rat: 92%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: FIHKALHTGEKPYECEECDKVFSRKSHLERHKRIHTGEKPYKCKVCDEAF
• Concentration: 0.5 mg/ml
• Blocking Peptide: Catalog # AAP50879 (Previous Catalog # AAPS30403)
• Reference: Sun,L., Biochem. Genet. 43 (5-6), 271-286 (2005)

Target Info

• Gene Symbol: ZNF468
• Gene Full Name: Zinc finger protein 468
• Alias Symbols: DKFZp781B1474, DKFZp781N07108
• NCBI Gene Id: 90333
• Protein Name: Zinc finger protein 468
• Description of Target: ZNF468 may be involved in transcriptional regulation.
• Uniprot ID: Q5VIY5
• Protein Accession #: NP_001008801
• Nucleotide Accession #: NM_001008801
• Protein Size (# AA): 522
• Molecular Weight: 60kDa
• Protein Interactions: AATF; SLC9A3R1; UBC;