SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP48228_T100
Price: $0.00
SKU
ARP48228_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

TCAP Antibody - middle region (ARP48228_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-TCAP (ARP48228_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TCAP
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: IQLQELLALETALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSM
Concentration1.0 mg/ml
Blocking PeptideFor anti-TCAP (ARP48228_T100) antibody is Catalog # AAP48228 (Previous Catalog # AAPS23002)
ReferenceBos,J.M., (2008) Am. Heart J. 155 (6), 1128-1134
Gene SymbolTCAP
Gene Full NameTitin-cap (telethonin)
Alias SymbolsTELE, CMD1N, CMH25, T-cap, LGMD2G, LGMDR7, telethonin
NCBI Gene Id8557
Protein NameTelethonin
Description of TargetSarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. TCAP is a protein found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in TCAP gene are associated with limb-girdle muscular dystrophy type 2G.Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. This gene encodes a protein found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in this gene are associated with limb-girdle muscular dystrophy type 2G. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDO15273
Protein Accession #NP_003664
Nucleotide Accession #NM_003673
Protein Size (# AA)167
Molecular Weight19kDa
Protein InteractionsTRIM63; TRIM55; RELA; FYN; FAS; ATXN1; MDM2; TTN; PDPK1; MYOZ3; ANKRD2; MYOZ1; MSTN; MYOZ2;
  1. What is the species homology for "TCAP Antibody - middle region (ARP48228_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "TCAP Antibody - middle region (ARP48228_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TCAP Antibody - middle region (ARP48228_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TCAP Antibody - middle region (ARP48228_T100)"?

    This target may also be called "TELE, CMD1N, CMH25, T-cap, LGMD2G, LGMDR7, telethonin" in publications.

  5. What is the shipping cost for "TCAP Antibody - middle region (ARP48228_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TCAP Antibody - middle region (ARP48228_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TCAP Antibody - middle region (ARP48228_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "19kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TCAP Antibody - middle region (ARP48228_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TCAP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TCAP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TCAP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TCAP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TCAP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TCAP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TCAP Antibody - middle region (ARP48228_T100)
Your Rating
We found other products you might like!