SRP54 Antibody - middle region (ARP40458_P050)

Catalog No: ARP40458_P050

WB Suggested Anti-SRP54 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

Hum. Adult Placenta

Host: Rabbit
Target: SRP54
Positive control (+): MCF7 (N10)
Negative control (-): 293T (2T)
Antibody concentration: 1ug/ml

SRP54 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with ARP40458_P050 with 1:200 dilution. Western blot was performed using ARP40458_P050 at 1/1000 dilution.
Lane 1: Control IP in HEK293 Whole Cell Lysate.
Lane 2: SRP54 IP with ARP40458_P050 in HEK293 Whole Cell Lysate.
Lane 3: Input of HEK293 Whole Cell Lysate.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IP
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SRP54
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SRP54 (ARP40458_P050) antibody is Catalog # AAP40458 (Previous Catalog # AAPP22226)
• Reference: Sakashita,E., (2004) Mol. Cell. Biol. 24 (3), 1174-1187

Target Info

• Gene Symbol: SRP54
• Gene Full Name: Signal recognition particle 54kDa
• Alias Symbols: SCN8
• NCBI Gene Id: 6729
• Protein Name: Signal recognition particle 54 kDa protein
• Description of Target: SRP54 belongs to the GTP-binding SRP family. It binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).
• Uniprot ID: P61011
• Protein Accession #: NP_003127
• Nucleotide Accession #: NM_003136
• Protein Size (# AA): 504
• Molecular Weight: 56kDa
• Protein Interactions: UBC; TARBP2; rev; SOX2; RNPS1; GEMIN4; GEMIN5; DDX20; GEMIN2; SRP68; SRP14; SRP9; SMN1; SF3B6; SF3A1; XRCC4; TFAP4; PRKDC; RNF185; SRP54; SRP19;