SND1 Antibody - N-terminal region (ARP32563_T100)

Catalog No: ARP32563_T100

WB Suggested Anti-SND1 Antibody Titration: 1.25ug/ml
Positive Control: Raji cell lysateSND1 is supported by BioGPS gene expression data to be expressed in Raji

Rabbit Anti-SND1 Antibody
Catalog Number: ARP32563_T100
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SND1
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQ
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-SND1 (ARP32563_T100) antibody is Catalog # AAP32563 (Previous Catalog # AAPP03566)
• Sample Type Confirmation:

  SND1 is supported by BioGPS gene expression data to be expressed in Raji

• Reference: Yang,J., et al., (2002) EMBO J. 21 (18), 4950-4958

Target Info

• Gene Symbol: SND1
• Gene Full Name: Staphylococcal nuclease and tudor domain containing 1
• Alias Symbols: p100, TDRD11, Tudor-SN
• NCBI Gene Id: 27044
• Protein Name: Staphylococcal nuclease domain-containing protein 1
• Description of Target: SND1 was originally characterized as a transcriptional coactivator for Epstein-Barr virus nuclear antigen 2. It is a STAT6 TAD interacting protein containing staphylococcal nuclease (SN)-like domain and tudor domain. p100 . The interaction is mediated by the TAD domain of STAT6 and the SN-like domain of SND1. SND1 associates with the large subunit of RNA polymerase II and is mediating interaction between STAT6 and RNA polymerase II. It was identified as a novel coactivator for STAT6 and suggest its functions as a bridging factor between STAT6 and the basal transcription machinery
• Uniprot ID: Q7KZF4
• Protein Accession #: NP_055205
• Nucleotide Accession #: NM_014390
• Protein Size (# AA): 885
• Molecular Weight: 100kDa
• Protein Interactions: HUWE1; RAPGEF2; UBC; SUMO2; MDM2; LIN28A; SHFM1; DDX3X; EIF3CL; RPL35; RPS27; RPS26; RPS16; RPS11; RPS9; RPS6; RPS3A; RPS2; RPL23A; HNRNPU; TARDBP; UBD; RNU4-1; RNU5A-1; RNU6-1; PRPF8; RNU2-1; RNU1-1; G3BP1; VCAM1; MAK; ITGA4; FN1; CSNK2A1; SSR3; SRSF3; R