SAT2 Antibody - C-terminal region (ARP72664_P050)

Catalog No: ARP72664_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: SAT2
Sample Type: THP-1 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SAT2
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: YLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SAT2 (ARP72664_P050) antibody is Catalog # AAP72664

Target Info

• Gene Symbol: SAT2
• Alias Symbols: SSAT2, SSAT-2
• NCBI Gene Id: 112483
• Description of Target: SAT2 is an enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine > spermidine = spermine >> N(1)acetylspermine = putrescine. .
• Uniprot ID: Q96F10
• Protein Accession #: NP_597998
• Protein Size (# AA): 170
• Molecular Weight: 18kDa
• Protein Interactions: SAT2; KAT2B; VHL; TCEB1; HIF1A; SAT1; TGFBR1;