SLC10A1 Antibody - middle region (ARP42097_P050)

Catalog No: ARP42097_P050

Host: Rabbit
Target Name: SLC10A1
Sample Tissue: Human MDA-MB-435s
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: SLC10A1
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 1ug/ml

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC10A1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SLC10A1 (ARP42097_P050) antibody is Catalog # AAP42097 (Previous Catalog # AAPP24576)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Dias,V. (2007) Fundam Clin Pharmacol 21 (4), 445-450
• Publications:

  Mapping the Cell-Surface N-Glycoproteome of Human Hepatocytes Reveals Markers for Selecting a Homogeneous Population of iPSC-Derived Hepatocytes. Stem Cell Reports. 7, 543-556 (2016). 27569060

• Description:
  View product citations for SLC10A1 Antibody - middle region (ARP42097_P050) on CiteAb

Target Info

• Gene Symbol: SLC10A1
• Gene Full Name: Solute carrier family 10 (sodium/bile acid cotransporter family), member 1
• Alias Symbols: NTCP, FHCA2
• NCBI Gene Id: 6554
• Protein Name: Sodium/bile acid cotransporter
• Description of Target: Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids, one absorbing from the intestinal lumen, the b
• Uniprot ID: Q14973
• Protein Accession #: NP_003040
• Nucleotide Accession #: NM_003049
• Protein Size (# AA): 349
• Molecular Weight: 38 kDa
• Protein Interactions: C11orf74;