LAMP3 Antibody - N-terminal region (ARP41598_P050)

Catalog No: ARP41598_P050

WB Suggested Anti-LAMP3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate

Host: Rabbit
Target: LAMP3
Positive control (+): Human Lung (LU)
Negative control (-): Human Brain (BR)
Antibody concentration: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LAMP3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LAMP3 (ARP41598_P050) antibody is Catalog # AAP41598 (Previous Catalog # AAPP24281)
• Reference: Lebre,M.C., (2008) Am. J. Pathol. 172 (4), 940-950
• Publications:

  Lysosome-associated membrane glycoprotein 3 is involved in influenza A virus replication in human lung epithelial (A549) cells. Virol J. 8, 384 (2011). 21810281

  Reduced glucocerebrosidase is associated with increased α-synuclein in sporadic Parkinson's disease. Brain. 137, 834-48 (2014). 24477431

• Description:
  View product citations for LAMP3 Antibody - N-terminal region (ARP41598_P050) on CiteAb

Target Info

• Gene Symbol: LAMP3
• Gene Full Name: Lysosomal-associated membrane protein 3
• Alias Symbols: LAMP, CD208, DCLAMP, LAMP-3, TSC403, DC LAMP, DC-LAMP
• NCBI Gene Id: 27074
• Protein Name: Lysosome-associated membrane glycoprotein 3
• Description of Target: LAMP3 might change the lysosome function after the transfer of peptide-MHC class II molecules to the surface of dendritic cells. LAMP3 overexpression is associated with an enhanced metastatic potential and may be a prognostic factor for cervical cancer.
• Uniprot ID: Q9UQV4
• Protein Accession #: NP_055213
• Nucleotide Accession #: NM_014398
• Protein Size (# AA): 416
• Molecular Weight: 44kDa
• Protein Interactions: SGTB;