- Description of Target:
- AR has 3 major functional domains: the N-terminal domain, DNA-binding domain, and androgen-binding domain. The protein functions as a steroid-hormone activated transcription factor. Upon binding the hormone ligand, the receptor dissociates from accessory proteins, translocates into the nucleus, dimerizes, and then stimulates transcription of androgen responsive genes. This gene contains 2 polymorphic trinucleotide repeat segments that encode polyglutamine and polyglycine tracts in the N-terminal transactivation domain of its protein. Expansion of the polyglutamine tract causes spinal bulbar muscular atrophy (Kennedy disease). Mutations in this gene are also associated with complete androgen insensitivity (CAIS).The androgen receptor gene is more than 90 kb long and codes for a protein that has 3 major functional domains: the N-terminal domain, DNA-binding domain, and androgen-binding domain. The protein functions as a steroid-hormone activated transcription factor. Upon binding the hormone ligand, the receptor dissociates from accessory proteins, translocates into the nucleus, dimerizes, and then stimulates transcription of androgen responsive genes. This gene contains 2 polymorphic trinucleotide repeat segments that encode polyglutamine and polyglycine tracts in the N-terminal transactivation domain of its protein. Expansion of the polyglutamine tract causes spinal bulbar muscular atrophy (Kennedy disease). Mutations in this gene are also associated with complete androgen insensitivity (CAIS). Two alternatively spliced variants encoding distinct isoforms have been described.
- Gene Symbol:
- AR
- Official Gene Full Name:
- Androgen receptor
- Alias Symbols:
- AIS; DHTR; HUMARA; KD; NR3C4; SBMA; SMAX1; TFM; HYSP1
- Tissue Tool:
- Find tissues and cell lines supported to express AR.
- Protein Accession# :
- NP_000035
- Nucleotide Accession#:
- NM_000044
- Swissprot Id:
- P10275
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 920
- Molecular Weight:
- 99kDa
- Application:
- WB
- Partner Proteins:
- ACTA1, ACTG1, AR, FKBP4, HSP90AA1, HSPA4, NR3C1, PIAS1, PIAS3, PROX1, PTGES3, TRIM24, NR3C1, PTGES3, TRIM24
- Immunogen:
- The immunogen for anti-AR antibody: synthetic peptide directed towards the N terminal of human AR
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- AR antibody - N-terminal region (ARP30974_P050)
- Predicted Homology Based on Immunogen Sequence:
- Horse: 100%; Human: 100%; Pig: 100%; Guinea pig: 92%; Mouse: 92%; Bovine: 85%; Rabbit: 85%
- Datasheets / Downloads:
- Printable datasheet for
anti-AR antibody
- ARP30974_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPP
- Blocking Peptide:
- For anti-AR antibody is Catalog # AAP30974 (Previous Catalog # AAPP24017)
- Key Reference:
- Hsu,F.C., (2008) Cancer Genet. Cytogenet. 183 (2), 94-98
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-AR antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: AR antibody tested with Human Jurkat Cells (ARP30974_P050)
Aviva Systems Biology is the original manufacturer of this AR antibody (ARP30974_P050)
Click here to view the AR antibody Western Blot Protocol
Product Datasheet Link: AR antibody (ARP30974_P050)
WB Suggested Anti-AR Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat
Western Blot image: 
Description of Target: AR has 3 major functional domains: the N-terminal domain, DNA-binding domain, and androgen-binding domain. The protein functions as a steroid-hormone activated transcription factor. Upon binding the hormone ligand, the receptor dissociates from accessory proteins, translocates into the nucleus, dimerizes, and then stimulates transcription of androgen responsive genes. This gene contains 2 polymorphic trinucleotide repeat segments that encode polyglutamine and polyglycine tracts in the N-terminal transactivation domain of its protein. Expansion of the polyglutamine tract causes spinal bulbar muscular atrophy (Kennedy disease). Mutations in this gene are also associated with complete androgen insensitivity (CAIS).The androgen receptor gene is more than 90 kb long and codes for a protein that has 3 major functional domains: the N-terminal domain, DNA-binding domain, and androgen-binding domain. The protein functions as a steroid-hormone activated transcription factor. Upon binding the hormone ligand, the receptor dissociates from accessory proteins, translocates into the nucleus, dimerizes, and then stimulates transcription of androgen responsive genes. This gene contains 2 polymorphic trinucleotide repeat segments that encode polyglutamine and polyglycine tracts in the N-terminal transactivation domain of its protein. Expansion of the polyglutamine tract causes spinal bulbar muscular atrophy (Kennedy disease). Mutations in this gene are also associated with complete androgen insensitivity (CAIS). Two alternatively spliced variants encoding distinct isoforms have been described.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s AR antibody (ARP30974_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
