Gnaq Antibody - middle region (ARP54636_P050)

Catalog No: ARP54636_P050

WB Suggested Anti-Gnaq Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Brain

Product Info

• Tested Species Reactivity: Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: RRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Gnaq (ARP54636_P050) antibody is Catalog # AAP54636
• Subunit: alpha

Target Info

• Gene Symbol: Gnaq
• Gene Full Name: Guanine nucleotide binding protein (G protein), q polypeptide
• Alias Symbols: Galphaq
• NCBI Gene Id: 81666
• Protein Name: Guanine nucleotide-binding protein G(q) subunit alpha
• Description of Target: Gnaq may mediate cardiomyocyte growth and hypertrophy; overexpression may facilitate apoptosis by inhibiting the PI3K/phosphoinositide-dependent kinase-1/Akt cell survival signaling pathway.
• Uniprot ID: P82471
• Protein Accession #: NP_112298
• Nucleotide Accession #: NM_031036
• Protein Size (# AA): 359
• Molecular Weight: 39kDa
• Protein Interactions: Ubc;