PLEKHO1 Antibody - N-terminal region (ARP47817_P050)

Catalog No: ARP47817_P050

WB Suggested Anti-PLEKHO1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: COLO205 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLEKHO1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Human: 100%; Pig: 86%; Rat: 82%
• Peptide Sequence: Synthetic peptide located within the following region: MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PLEKHO1 (ARP47817_P050) antibody is Catalog # AAP47817 (Previous Catalog # AAPS18711)

Target Info

• Gene Symbol: PLEKHO1
• Gene Full Name: Pleckstrin homology domain containing, family O member 1
• Alias Symbols: JBP, CKIP1, OC120, CKIP-1
• NCBI Gene Id: 51177
• Protein Name: Pleckstrin homology domain-containing family O member 1
• Description of Target: PLEKHO1 plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP).PLEKHO1 may function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). PLEKHO1 appears to target ATM to the plasma membrane. PLEKHO1 appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. PLEKHO1 is also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation.
• Uniprot ID: Q53GL0
• Protein Accession #: NP_057358
• Nucleotide Accession #: NM_016274
• Protein Size (# AA): 409
• Molecular Weight: 46kDa
• Protein Interactions: PLEKHO1; AKT3; AKT2; AKT1; UBC; GSK3B; TRAF6; Arpc1a; Stub1; Rps3a1; SMURF1; PSMC5; USP7; C10orf88; RPS20; IFI35; DNAJB1; FLNB; CSNK2A1; SMAD5; JUND; JUN; CASP3;