GNPTAB Antibody - N-terminal region (ARP49815_P050)

Catalog No: ARP49815_P050

WB Suggested Anti-GNPTAB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNPTAB
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: FQFGEVVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GNPTAB (ARP49815_P050) antibody is Catalog # AAP49815 (Previous Catalog # AAPP44201)
• Subunit: s alpha/beta

Target Info

• Gene Symbol: GNPTAB
• Gene Full Name: N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits
• Alias Symbols: ICD, GNPTA
• NCBI Gene Id: 79158
• Protein Name: N-acetylglucosamine-1-phosphotransferase subunits alpha/beta
• Description of Target: This gene encodes two of three subunit types of the membrane-bound enzyme N-acetylglucosamine-1-phosphotransferase, a heterohexameric complex composed of two alpha, two beta, and two gamma subunits. The encoded protein is proteolytically cleaved at the Lys928-Asp929 bond to yield mature alpha and beta polypeptides while the gamma subunits are the product of a distinct gene (GeneID 84572). In the Golgi apparatus, the heterohexameric complex catalyzes the first step in the synthesis of mannose 6-phosphate recognition markers on certain oligosaccharides of newly synthesized lysosomal enzymes. These recognition markers are essential for appropriate trafficking of lysosomal enzymes. Mutations in this gene have been associated with both mucolipidosis II and mucolipidosis IIIA.
• Uniprot ID: Q3T906
• Protein Accession #: NP_077288
• Nucleotide Accession #: NM_024312
• Protein Size (# AA): 1256
• Molecular Weight: 143kDa
• Protein Interactions: AEN; ZNF250; STAMBPL1; FAM90A1; PSMA1; MAPK1; APP; UBC; DISC1;